General Information of This Antibody (ID: ANTI0YTAQP)
Antibody Name
B31-H3L3
Organization
HANGZHOU ZHONGMEIHUADONG PHARMACEUTICAL CO. LTD. | SANYOU BIOPHARMACEUTICALS CO. LTD.
Synonyms
B31-H3L3
   Click to Show/Hide
Antibody Type
Monoclonal antibody (mAb)
Antibody Subtype
Humanized lgG
Antigen Name
Inactive tyrosine-protein kinase transmembrane receptor ROR1 (ROR1)
 Antigen Info 
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFTFSRYAMSWVRQAPGKGLEWVASISRGGSTYYA
DSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCASYFGNYDAMDYWGQGTTVTVSSAS
TKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGL
YSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPS
VFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNST
YRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELT
KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQ
GNVFSCSVMHEALHNHYTQKSLSLSPGK
    Click to Show/Hide
Heavy Chain Varible Domain
EVQLVESGGGLVQPGGSLRLSCAASGFTFSRYAMSWVRQAPGKGLEWVASISRGGSTYYA
DSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCASYFGNYDAMDYWGQGTTVTVSS
    Click to Show/Hide
Heavy Chain CDR 1
GFTFSRYAMS
    Click to Show/Hide
Heavy Chain CDR 2
SISRGGSTY
    Click to Show/Hide
Heavy Chain CDR 3
YFGNYDAMDY
    Click to Show/Hide
Light Chain Sequence
DIQMTQSPSSLSASVGDRVTITCRASQDINNYVSWFQQKPGKAPKSLIYRANRLVSGVPS
RFSGSGSGTDFTFTISSLQPEDFATYYCLQFDEFPYTFGGGTKLEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
    Click to Show/Hide
Light Chain Varible Domain
DIQMTQSPSSLSASVGDRVTITCRASQDINNYVSWFQQKPGKAPKSLIYRANRLVSGVPS
RFSGSGSGTDFTFTISSLQPEDFATYYCLQFDEFPYTFGGGTKLEIK
    Click to Show/Hide
Light Chain CDR 1
RASQDINNYVS
    Click to Show/Hide
Light Chain CDR 2
RANRLS
    Click to Show/Hide
Light Chain CDR 3
LQFDEFPYT
    Click to Show/Hide
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
CO20240013452A2 ADC1 (2) [Investigative]
Discovered Using Cell Line-derived Xenograft Model
Click To Hide/Show 15 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth lnhibition value (TGl)
15.37%
Positive ROR1 expression (ROR1+++/++)
Method Description
Female Balb/C nude mice between 6-8 weeks of age were injected subcutaneously withHT-29 cells, when tumors reached appproximately 100 mm^3, animals were matched by tumor volume into treatment or controls groups. The test articles were given by tail vein at a dose (2 mg/kg) (BIW&#424).
In Vivo Model HT-29 xenograft model
Experiment 2 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth lnhibition value (TGl)
16.05%
Positive ROR1 expression (ROR1+++/++)
Method Description
Female Balb/C nude mice between 6-8 weeks of age were injected subcutaneously withHT-29 cells, when tumors reached appproximately 100 mm^3, animals were matched by tumor volume into treatment or controls groups. The test articles were given by tail vein at a dose (0.4 mg/kg) (BIW&#424).
In Vivo Model HT-29 xenograft model
Experiment 3 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth lnhibition value (TGl)
34.96%
Positive ROR1 expression (ROR1+++/++)
Method Description
Female Balb/C nude mice between 6-8 weeks of age were injected subcutaneously with Jeko-1 cells, when tumors reached appproximately 100 mm^3, animals were matched by tumor volume into treatment or controls groups. The test articles were given by tail vein at a dose (2.5 mg/kg- D15, 3.5 mg/kg- D29) (Q2W&#422).
In Vivo Model Jeko-1 xenograft model
Experiment 4 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth lnhibition value (TGl)
43.98%
Positive ROR1 expression (ROR1+++/++)
Method Description
Female Balb/C nude mice between 6-8 weeks of age were injected subcutaneously with A549 cells, when tumors reached appproximately 100 mm^3, animals were matched by tumor volume into treatment or controls groups. The test articles were given by tail vein at a dose (10 mg/kg) (BIW&#423).
In Vivo Model A549 xenograft model
Experiment 5 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth lnhibition value (TGl)
60.47%
Positive ROR1 expression (ROR1+++/++)
Method Description
Female Balb/C nude mice between 6-8 weeks of age were injected subcutaneously with Jeko-1 cells, when tumors reached appproximately 100 mm^3, animals were matched by tumor volume into treatment or controls groups. The test articles were given by tail vein at a dose (2.5 mg/kg) (QW&#423).
In Vivo Model Jeko-1 xenograft model
Experiment 6 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth lnhibition value (TGl)
79.24%
Positive ROR1 expression (ROR1+++/++)
Method Description
Female Balb/C nude mice between 6-8 weeks of age were injected subcutaneously with Jeko-1 cells, when tumors reached appproximately 100 mm^3, animals were matched by tumor volume into treatment or controls groups. The test articles were given by tail vein at a dose (10 mg/kg) once.
In Vivo Model Jeko-1 xenograft model
Experiment 7 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth lnhibition value (TGl)
79.79%
Positive ROR1 expression (ROR1+++/++)
Method Description
Female Balb/C nude mice between 6-8 weeks of age were injected subcutaneously with MDA-MB-231 cells, when tumors reached appproximately 100 mm^3, animals were matched by tumor volume into treatment or controls groups. The test articles were given by tail vein at a dose (5 mg/kg) (QW&#423).
In Vivo Model MDA-MB-231 xenograft model
Experiment 8 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth lnhibition value (TGl)
85.53%
Positive ROR1 expression (ROR1+++/++)
Method Description
Female Balb/C nude mice between 6-8 weeks of age were injected subcutaneously withHT-29 cells, when tumors reached appproximately 100 mm^3, animals were matched by tumor volume into treatment or controls groups. The test articles were given by tail vein at a dose (10 mg/kg) (BIW&#424).
In Vivo Model HT-29 xenograft model
Experiment 9 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth lnhibition value (TGl)
91.52%
Positive ROR1 expression (ROR1+++/++)
Method Description
Female Balb/C nude mice between 6-8 weeks of age were injected subcutaneously with NCI-N87 cells, when tumors reached appproximately 100 mm^3, animals were matched by tumor volume into treatment or controls groups. The test articles were given by tail vein at a dose (5 mg/kg) (QW&#423).
In Vivo Model NCI-N87 xenograft model
Experiment 10 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth lnhibition value (TGl)
95.44%
Positive ROR1 expression (ROR1+++/++)
Method Description
Female Balb/C nude mice between 6-8 weeks of age were injected subcutaneously with Jeko-1 cells, when tumors reached appproximately 100 mm^3, animals were matched by tumor volume into treatment or controls groups. The test articles were given by tail vein at a dose (10 mg/kg) (QW&#423).
In Vivo Model Jeko-1 xenograft model
Experiment 11 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth lnhibition value (TGl)
96.60%
Positive ROR1 expression (ROR1+++/++)
Method Description
Female Balb/C nude mice between 6-8 weeks of age were injected subcutaneously with MDA-MB-231 cells, when tumors reached appproximately 100 mm^3, animals were matched by tumor volume into treatment or controls groups. The test articles were given by tail vein at a dose (10 mg/kg) (QW&#423).
In Vivo Model MDA-MB-231 xenograft model
Experiment 12 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth lnhibition value (TGl)
98.02%
Positive ROR1 expression (ROR1+++/++)
Method Description
Female NOD SCID nude mice between 6-8 weeks of age were injected subcutaneously with MDA-MB-4681 cells, when tumors reached appproximately 200 mm^3, animals were matched by tumor volume into treatment or controls groups. The test articles were given by tail vein at a dose (5 mg/kg) (QW&#423).
In Vivo Model MDA-MB-468 xenograft model
Experiment 13 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth lnhibition value (TGl)
99.31%
Positive ROR1 expression (ROR1+++/++)
Method Description
Female Balb/C nude mice between 6-8 weeks of age were injected subcutaneously with NCI-N87 cells, when tumors reached appproximately 100 mm^3, animals were matched by tumor volume into treatment or controls groups. The test articles were given by tail vein at a dose (10 mg/kg) (QW&#423).
In Vivo Model NCI-N87 xenograft model
Experiment 14 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth lnhibition value (TGl)
100%
Positive ROR1 expression (ROR1+++/++)
Method Description
Female NOD SCID nude mice between 6-8 weeks of age were injected subcutaneously with MDA-MB-4681 cells, when tumors reached appproximately 200 mm^3, animals were matched by tumor volume into treatment or controls groups. The test articles were given by tail vein at a dose (10 mg/kg) (QW&#423).
In Vivo Model MDA-MB-468 xenograft model
Experiment 15 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth lnhibition value (TGl)
100%
Positive ROR1 expression (ROR1+++/++)
Method Description
Female NOD SCID nude mice between 6-8 weeks of age were injected subcutaneously with MDA-MB-4681 cells, when tumors reached appproximately 200 mm^3, animals were matched by tumor volume into treatment or controls groups. The test articles were given by tail vein at a dose (10 mg/kg) once.
In Vivo Model MDA-MB-468 xenograft model
Revealed Based on the Cell Line Data
Click To Hide/Show 5 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Effective Concentration (EC50)
15.24 nM
Method Description
ADCs were tested in MDA-MB-468 cells, and were added at final working concentration at 500 nM, 158 nM, 50 nM, 15.8 nM, 5 nM, 1.58 nM, 0.5 nM, 0.158 nM, 0.05 Nm, incubated for 3 days.
In Vitro Model Breast adenocarcinoma MDA-MB-468 cells CVCL_0419
Experiment 2 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Effective Concentration (EC50)
38.24 nM
Method Description
ADCs were tested in Jeko-1 cells, and were added at final working concentration at 500 nM, 158 nM, 50 nM, 15.8 nM, 5 nM, 1.58 nM, 0.5 nM, 0.158 nM, 0.05 Nm, incubated for 3 days.
In Vitro Model Mantle cell lymphoma JeKo-1 cells CVCL_1865
Experiment 3 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Effective Concentration (EC50)
58.45 nM
Method Description
ADCs were tested in HT-29 cells, and were added at final working concentration at 2000 nM, 500 nM, 250 nM, 125 nM, 62.5 nM, 31.25 nM, 15.625 nM, 7.813 nM, 1.953 nM, incubated for 4 days.
In Vitro Model Colon adenocarcinoma HT-29 cells CVCL_0320
Experiment 4 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Effective Concentration (EC50)
117.3 nM
Method Description
ADCs were tested in NCI-H1944 cells, and were added at final working concentration at 500 nM, 158 nM, 50 nM, 15.8 nM, 5 nM, 1.58 nM, 0.5 nM, 0.158 nM, 0.05 Nm, incubated for 3 days.
In Vitro Model Lung adenocarcinoma NCI-H1944 cells CVCL_1508
Experiment 5 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Effective Concentration (EC50)
280.6 nM
Method Description
ADCs were tested in A549 cells, and were added at final working concentration at 2000 nM, 500 nM, 250 nM, 125 nM, 62.5 nM, 31.25 nM, 15.625 nM, 7.813 nM, 1.953 nM, incubated for 3 days.
In Vitro Model Lung adenocarcinoma A549 cells CVCL_0023
KR1020250008730A ADC2 [Investigative]
Discovered Using Cell Line-derived Xenograft Model
Click To Hide/Show 15 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [2]
Efficacy Data Tumor Growth lnhibition value (TGl)
15.37%
Method Description
A xenograft model derived from cell lines was established by unilateral subcutaneous injection of 1×10^6 HT-29 cells into female Balb/C nude mice. When the tumor volume reached approximately 100 mm^3, B31-H3L3-MMAE was administered at a dose of 2 mg/kg. The treatment was given twice a week for 4 weeks. The tumor inhibition rate was calculated at the end of the experiment.

   Click to Show/Hide
In Vivo Model HT-29-xenograft model
Experiment 2 Reporting the Activity Date of This ADC [2]
Efficacy Data Tumor Growth lnhibition value (TGl)
16.05%
Method Description
A xenograft model derived from cell lines was established by unilateral subcutaneous injection of 1×10^6 HT-29 cells into female Balb/C nude mice. When the tumor volume reached approximately 100 mm^3, B31-H3L3-MMAE was administered at a dose of 0.4 mg/kg. The treatment was given twice a week for 4 weeks. The tumor inhibition rate was calculated at the end of the experiment.

   Click to Show/Hide
In Vivo Model HT-29-xenograft model
Experiment 3 Reporting the Activity Date of This ADC [2]
Efficacy Data Tumor Growth lnhibition value (TGl)
34.96%
Method Description
A xenograft model derived from cell lines was established by injecting 1×10^7 Jeko cells subcutaneously into the left side of female Balb/C nude mice. When the tumor volume reached approximately 100 mm^3, B31-H3L3-MMAE at doses of 2.5 mg/kg and 3.5 mg/kg was administered on the 15th and 29th days respectively. The tumor inhibition rate was calculated at the end of the experiment.

   Click to Show/Hide
In Vivo Model Jeko-1-xenograft model
Experiment 4 Reporting the Activity Date of This ADC [2]
Efficacy Data Tumor Growth lnhibition value (TGl)
43.98%
Method Description
A xenograft model derived from cell lines was established by unilateral subcutaneous injection of 1×10^6 A549 cells into female Balb/C nude mice. When the tumor volume reached approximately 100 mm^3, B31-H3L3-MMAE was administered at a dose of 10 mg/kg. The treatment was given twice a week for 3 weeks. The tumor inhibition rate was calculated at the end of the experiment.

   Click to Show/Hide
In Vivo Model A549-xenograft model
Experiment 5 Reporting the Activity Date of This ADC [2]
Efficacy Data Tumor Growth lnhibition value (TGl)
60.47%
Method Description
A xenograft model derived from cell lines was established by injecting 1×10^7 Jeko cells subcutaneously into the left side of female Balb/C nude mice. When the tumor volume reached approximately 100 mm^3, B31-H3L3-MMAE was administered at a dose of 2.5 mg/kg. The treatment was given once a week for 3 weeks. The tumor inhibition rate was calculated at the end of the experiment.

   Click to Show/Hide
In Vivo Model Jeko-1-xenograft model
Experiment 6 Reporting the Activity Date of This ADC [2]
Efficacy Data Tumor Growth lnhibition value (TGl)
79.24%
Method Description
A xenograft model derived from cell lines was established by injecting 1×10^7 Jeko-1 cells subcutaneously into the left side of female Balb/C nude mice. When the tumor volume reached approximately 100 mm^3, B31-H3L3-MMAE was administered at a dose of 10 mg/kg once. The tumor inhibition rate was calculated at the end of the experiment.
In Vivo Model Jeko-1-xenograft model
Experiment 7 Reporting the Activity Date of This ADC [2]
Efficacy Data Tumor Growth lnhibition value (TGl)
79.79%
Method Description
A xenograft model derived from the cell line was established by injecting 1×10^6 MDA-MB-231 cells subcutaneously into the left side of female Balb/C nude mice. When the tumor volume reached approximately 100 mm^3, B31-H3L3-MMAE was administered at a dose of 5 mg/kg. The treatment was given once a week for 3 weeks. The tumor inhibition rate was calculated at the end of the experiment.

   Click to Show/Hide
In Vivo Model MDA-MB-231-xenograft model
Experiment 8 Reporting the Activity Date of This ADC [2]
Efficacy Data Tumor Growth lnhibition value (TGl)
85.53%
Method Description
A xenograft model derived from cell lines was established by unilateral subcutaneous injection of 1×10^6 HT-29 cells into female Balb/C nude mice. When the tumor volume reached approximately 100 mm^3, B31-H3L3-MMAE was administered at a dose of 10 mg/kg. The treatment was given twice a week for 4 weeks. The tumor inhibition rate was calculated at the end of the experiment.

   Click to Show/Hide
In Vivo Model HT-29-xenograft model
Experiment 9 Reporting the Activity Date of This ADC [2]
Efficacy Data Tumor Growth lnhibition value (TGl)
91.52%
Method Description
A xenograft model derived from the cell line was established by injecting 1×10^6 NCI-N87 cells subcutaneously into the left side of female Balb/C nude mice. When the tumor volume reached approximately 100 mm^3, B31-H3L3-MMAE was administered at a dose of 5 mg/kg. The treatment was given once a week for 3 weeks. The tumor inhibition rate was calculated at the end of the experiment.

   Click to Show/Hide
In Vivo Model NCI-N87-xenograft model
Experiment 10 Reporting the Activity Date of This ADC [2]
Efficacy Data Tumor Growth lnhibition value (TGl)
95.44%
Method Description
A xenograft model derived from cell lines was established by injecting 1×10^7 Jeko cells subcutaneously into the left side of female Balb/C nude mice. When the tumor volume reached approximately 100 mm^3, B31-H3L3-MMAE was administered at a dose of 10 mg/kg. The treatment was given once a week for 3 weeks. The tumor inhibition rate was calculated at the end of the experiment.

   Click to Show/Hide
In Vivo Model Jeko-1-xenograft model
Experiment 11 Reporting the Activity Date of This ADC [2]
Efficacy Data Tumor Growth lnhibition value (TGl)
96.60%
Method Description
A xenograft model derived from the cell line was established by injecting 1×10^6 MDA-MB-231 cells subcutaneously into the left side of female Balb/C nude mice. When the tumor volume reached approximately 100 mm^3, B31-H3L3-MMAE was administered at a dose of 10 mg/kg. The treatment was given once a week for 3 weeks. The tumor inhibition rate was calculated at the end of the experiment.

   Click to Show/Hide
In Vivo Model MDA-MB-231-xenograft model
Experiment 12 Reporting the Activity Date of This ADC [2]
Efficacy Data Tumor Growth lnhibition value (TGl)
98.02%
Method Description
A xenograft model derived from the cell line was established by injecting 1×10^7 MDA-MB-468 cells subcutaneously into the left side of female Balb/C nude mice. When the tumor volume reached approximately 100 mm^3, B31-H3L3-MMAE was administered at a dose of 5 mg/kg. The treatment was given once a week for 4 weeks. The tumor inhibition rate was calculated at the end of the experiment.

   Click to Show/Hide
In Vivo Model MDA-MB-468-xenograft model
Experiment 13 Reporting the Activity Date of This ADC [2]
Efficacy Data Tumor Growth lnhibition value (TGl)
99.31%
Method Description
A xenograft model derived from the cell line was established by injecting 1×10^6 NCI-N87 cells subcutaneously into the left side of female Balb/C nude mice. When the tumor volume reached approximately 100 mm^3, B31-H3L3-MMAE was administered at a dose of 10 mg/kg. The treatment was given once a week for 3 weeks. The tumor inhibition rate was calculated at the end of the experiment.

   Click to Show/Hide
In Vivo Model NCI-N87-xenograft model
Experiment 14 Reporting the Activity Date of This ADC [2]
Efficacy Data Tumor Growth lnhibition value (TGl)
100%
Method Description
A xenograft model derived from the cell line was established by injecting 1×10^7 MDA-MB-468 cells subcutaneously into the left side of female Balb/C nude mice. When the tumor volume reached approximately 100 mm^3, B31-H3L3-MMAE was administered at a dose of 10 mg/kg. The treatment was given once a week for 4 weeks. The tumor inhibition rate was calculated at the end of the experiment.

   Click to Show/Hide
In Vivo Model MDA-MB-468-xenograft model
Experiment 15 Reporting the Activity Date of This ADC [2]
Efficacy Data Tumor Growth lnhibition value (TGl)
100%
Method Description
A xenograft model derived from cell lines was established by injecting 1×10^7 MDA-MB-468 cells subcutaneously into female BALB/C nude mice. When the tumor volume reached approximately 100 mm^3, B31-H3L3-MMAE was administered at a dose of 10 mg/kg once. The tumor inhibition rate was calculated at the end of the experiment.
In Vivo Model MDA-MB-468-xenograft model
Revealed Based on the Cell Line Data
Click To Hide/Show 3 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [2]
Efficacy Data Half Maximal Effective Concentration (EC55)
117.3 nM
Method Description
NCI-H1944 cells were added with ADC samples, and the drug concentration gradient was diluted to 500, 158, 50, 15.8, 5, 1.58, 0.5, 0.158, and 0.05 nM. The cells were cultured at 37°C with 5% CO2 for 72 hours. Then, 10 uL of LCK8 (Bimake, B34304) was added to each well, and the cells were incubated at 37°C for 1 hour. The data were read at OD450 using a microplate reader.

   Click to Show/Hide
In Vitro Model Lung adenocarcinoma NCI-H1944 cells CVCL_1508
Experiment 2 Reporting the Activity Date of This ADC [2]
Efficacy Data Half Maximal Effective Concentration (EC54)
15.24 nM
Method Description
MDA-MB-468 cells were added with ADC samples, and the drug concentration gradient was diluted to 500, 158, 50, 15.8, 5, 1.58, 0.5, 0.158, and 0.05 nM. The cells were cultured at 37°C with 5% CO2 for 72 hours. Then, 10 uL of LCK8 (Bimake, B34304) was added to each well, and the cells were incubated at 37°C for 1 hour. The data were read at OD450 using a microplate reader.

   Click to Show/Hide
In Vitro Model Breast adenocarcinoma MDA-MB-468 cells CVCL_0419
Experiment 3 Reporting the Activity Date of This ADC [2]
Efficacy Data Half Maximal Effective Concentration (EC53)
38.24 nM
Method Description
Jeko-1 cells were co-cultured with ADC samples, and the drug concentration gradient was diluted to 500, 158, 50, 15.8, 5, 1.58, 0.5, 0.158, and 0.05 nM. The cells were cultured at 37°C with 5% CO2 for 72 hours. Then, 10 uL of LCK8 (Bimake, B34304) was added to each well, and the reaction was incubated at 37°C for 1 hour. The data were read at OD450 using a microplate reader.

   Click to Show/Hide
In Vitro Model Mantle cell lymphoma JeKo-1 cells CVCL_1865
References
Ref 1 Binding molecule directed to ror1 and its use
Ref 2 Ror1-targeted binding molecules and their Applications