Antibody Information
General Information of This Antibody (ID: ANTI0YTAQP)
| Antibody Name | B31-H3L3 |
|||||
|---|---|---|---|---|---|---|
| Organization | HANGZHOU ZHONGMEIHUADONG PHARMACEUTICAL CO. LTD. | SANYOU BIOPHARMACEUTICALS CO. LTD. |
|||||
| Synonyms |
B31-H3L3
Click to Show/Hide
|
|||||
| Antibody Type | Monoclonal antibody (mAb) |
|||||
| Antibody Subtype | Humanized lgG |
|||||
| Antigen Name | Inactive tyrosine-protein kinase transmembrane receptor ROR1 (ROR1) |
Antigen Info | ||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Sequence |
EVQLVESGGGLVQPGGSLRLSCAASGFTFSRYAMSWVRQAPGKGLEWVASISRGGSTYYA
DSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCASYFGNYDAMDYWGQGTTVTVSSAS TKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGL YSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPS VFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNST YRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELT KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQ GNVFSCSVMHEALHNHYTQKSLSLSPGK Click to Show/Hide
|
|||||
| Heavy Chain Varible Domain |
EVQLVESGGGLVQPGGSLRLSCAASGFTFSRYAMSWVRQAPGKGLEWVASISRGGSTYYA
DSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCASYFGNYDAMDYWGQGTTVTVSS Click to Show/Hide
|
|||||
| Heavy Chain CDR 1 |
GFTFSRYAMS
Click to Show/Hide
|
|||||
| Heavy Chain CDR 2 |
SISRGGSTY
Click to Show/Hide
|
|||||
| Heavy Chain CDR 3 |
YFGNYDAMDY
Click to Show/Hide
|
|||||
| Light Chain Sequence |
DIQMTQSPSSLSASVGDRVTITCRASQDINNYVSWFQQKPGKAPKSLIYRANRLVSGVPS
RFSGSGSGTDFTFTISSLQPEDFATYYCLQFDEFPYTFGGGTKLEIKRTVAAPSVFIFPP SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Click to Show/Hide
|
|||||
| Light Chain Varible Domain |
DIQMTQSPSSLSASVGDRVTITCRASQDINNYVSWFQQKPGKAPKSLIYRANRLVSGVPS
RFSGSGSGTDFTFTISSLQPEDFATYYCLQFDEFPYTFGGGTKLEIK Click to Show/Hide
|
|||||
| Light Chain CDR 1 |
RASQDINNYVS
Click to Show/Hide
|
|||||
| Light Chain CDR 2 |
RANRLS
Click to Show/Hide
|
|||||
| Light Chain CDR 3 |
LQFDEFPYT
Click to Show/Hide
|
|||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
CO20240013452A2 ADC1 (2) [Investigative]
Discovered Using Cell Line-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth lnhibition value (TGl) |
15.37%
|
Positive ROR1 expression (ROR1+++/++) | ||
| Method Description |
Female Balb/C nude mice between 6-8 weeks of age were injected subcutaneously withHT-29 cells, when tumors reached appproximately 100 mm^3, animals were matched by tumor volume into treatment or controls groups. The test articles were given by tail vein at a dose (2 mg/kg) (BIWƨ).
|
||||
| In Vivo Model | HT-29 xenograft model | ||||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth lnhibition value (TGl) |
16.05%
|
Positive ROR1 expression (ROR1+++/++) | ||
| Method Description |
Female Balb/C nude mice between 6-8 weeks of age were injected subcutaneously withHT-29 cells, when tumors reached appproximately 100 mm^3, animals were matched by tumor volume into treatment or controls groups. The test articles were given by tail vein at a dose (0.4 mg/kg) (BIWƨ).
|
||||
| In Vivo Model | HT-29 xenograft model | ||||
| Experiment 3 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth lnhibition value (TGl) |
34.96%
|
Positive ROR1 expression (ROR1+++/++) | ||
| Method Description |
Female Balb/C nude mice between 6-8 weeks of age were injected subcutaneously with Jeko-1 cells, when tumors reached appproximately 100 mm^3, animals were matched by tumor volume into treatment or controls groups. The test articles were given by tail vein at a dose (2.5 mg/kg- D15, 3.5 mg/kg- D29) (Q2WƦ).
|
||||
| In Vivo Model | Jeko-1 xenograft model | ||||
| Experiment 4 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth lnhibition value (TGl) |
43.98%
|
Positive ROR1 expression (ROR1+++/++) | ||
| Method Description |
Female Balb/C nude mice between 6-8 weeks of age were injected subcutaneously with A549 cells, when tumors reached appproximately 100 mm^3, animals were matched by tumor volume into treatment or controls groups. The test articles were given by tail vein at a dose (10 mg/kg) (BIWƧ).
|
||||
| In Vivo Model | A549 xenograft model | ||||
| Experiment 5 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth lnhibition value (TGl) |
60.47%
|
Positive ROR1 expression (ROR1+++/++) | ||
| Method Description |
Female Balb/C nude mice between 6-8 weeks of age were injected subcutaneously with Jeko-1 cells, when tumors reached appproximately 100 mm^3, animals were matched by tumor volume into treatment or controls groups. The test articles were given by tail vein at a dose (2.5 mg/kg) (QWƧ).
|
||||
| In Vivo Model | Jeko-1 xenograft model | ||||
| Experiment 6 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth lnhibition value (TGl) |
79.24%
|
Positive ROR1 expression (ROR1+++/++) | ||
| Method Description |
Female Balb/C nude mice between 6-8 weeks of age were injected subcutaneously with Jeko-1 cells, when tumors reached appproximately 100 mm^3, animals were matched by tumor volume into treatment or controls groups. The test articles were given by tail vein at a dose (10 mg/kg) once.
|
||||
| In Vivo Model | Jeko-1 xenograft model | ||||
| Experiment 7 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth lnhibition value (TGl) |
79.79%
|
Positive ROR1 expression (ROR1+++/++) | ||
| Method Description |
Female Balb/C nude mice between 6-8 weeks of age were injected subcutaneously with MDA-MB-231 cells, when tumors reached appproximately 100 mm^3, animals were matched by tumor volume into treatment or controls groups. The test articles were given by tail vein at a dose (5 mg/kg) (QWƧ).
|
||||
| In Vivo Model | MDA-MB-231 xenograft model | ||||
| Experiment 8 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth lnhibition value (TGl) |
85.53%
|
Positive ROR1 expression (ROR1+++/++) | ||
| Method Description |
Female Balb/C nude mice between 6-8 weeks of age were injected subcutaneously withHT-29 cells, when tumors reached appproximately 100 mm^3, animals were matched by tumor volume into treatment or controls groups. The test articles were given by tail vein at a dose (10 mg/kg) (BIWƨ).
|
||||
| In Vivo Model | HT-29 xenograft model | ||||
| Experiment 9 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth lnhibition value (TGl) |
91.52%
|
Positive ROR1 expression (ROR1+++/++) | ||
| Method Description |
Female Balb/C nude mice between 6-8 weeks of age were injected subcutaneously with NCI-N87 cells, when tumors reached appproximately 100 mm^3, animals were matched by tumor volume into treatment or controls groups. The test articles were given by tail vein at a dose (5 mg/kg) (QWƧ).
|
||||
| In Vivo Model | NCI-N87 xenograft model | ||||
| Experiment 10 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth lnhibition value (TGl) |
95.44%
|
Positive ROR1 expression (ROR1+++/++) | ||
| Method Description |
Female Balb/C nude mice between 6-8 weeks of age were injected subcutaneously with Jeko-1 cells, when tumors reached appproximately 100 mm^3, animals were matched by tumor volume into treatment or controls groups. The test articles were given by tail vein at a dose (10 mg/kg) (QWƧ).
|
||||
| In Vivo Model | Jeko-1 xenograft model | ||||
| Experiment 11 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth lnhibition value (TGl) |
96.60%
|
Positive ROR1 expression (ROR1+++/++) | ||
| Method Description |
Female Balb/C nude mice between 6-8 weeks of age were injected subcutaneously with MDA-MB-231 cells, when tumors reached appproximately 100 mm^3, animals were matched by tumor volume into treatment or controls groups. The test articles were given by tail vein at a dose (10 mg/kg) (QWƧ).
|
||||
| In Vivo Model | MDA-MB-231 xenograft model | ||||
| Experiment 12 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth lnhibition value (TGl) |
98.02%
|
Positive ROR1 expression (ROR1+++/++) | ||
| Method Description |
Female NOD SCID nude mice between 6-8 weeks of age were injected subcutaneously with MDA-MB-4681 cells, when tumors reached appproximately 200 mm^3, animals were matched by tumor volume into treatment or controls groups. The test articles were given by tail vein at a dose (5 mg/kg) (QWƧ).
|
||||
| In Vivo Model | MDA-MB-468 xenograft model | ||||
| Experiment 13 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth lnhibition value (TGl) |
99.31%
|
Positive ROR1 expression (ROR1+++/++) | ||
| Method Description |
Female Balb/C nude mice between 6-8 weeks of age were injected subcutaneously with NCI-N87 cells, when tumors reached appproximately 100 mm^3, animals were matched by tumor volume into treatment or controls groups. The test articles were given by tail vein at a dose (10 mg/kg) (QWƧ).
|
||||
| In Vivo Model | NCI-N87 xenograft model | ||||
| Experiment 14 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth lnhibition value (TGl) |
100%
|
Positive ROR1 expression (ROR1+++/++) | ||
| Method Description |
Female NOD SCID nude mice between 6-8 weeks of age were injected subcutaneously with MDA-MB-4681 cells, when tumors reached appproximately 200 mm^3, animals were matched by tumor volume into treatment or controls groups. The test articles were given by tail vein at a dose (10 mg/kg) (QWƧ).
|
||||
| In Vivo Model | MDA-MB-468 xenograft model | ||||
| Experiment 15 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth lnhibition value (TGl) |
100%
|
Positive ROR1 expression (ROR1+++/++) | ||
| Method Description |
Female NOD SCID nude mice between 6-8 weeks of age were injected subcutaneously with MDA-MB-4681 cells, when tumors reached appproximately 200 mm^3, animals were matched by tumor volume into treatment or controls groups. The test articles were given by tail vein at a dose (10 mg/kg) once.
|
||||
| In Vivo Model | MDA-MB-468 xenograft model | ||||
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
15.24 nM
|
|||
| Method Description |
ADCs were tested in MDA-MB-468 cells, and were added at final working concentration at 500 nM, 158 nM, 50 nM, 15.8 nM, 5 nM, 1.58 nM, 0.5 nM, 0.158 nM, 0.05 Nm, incubated for 3 days.
|
||||
| In Vitro Model | Breast adenocarcinoma | MDA-MB-468 cells | CVCL_0419 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
38.24 nM
|
|||
| Method Description |
ADCs were tested in Jeko-1 cells, and were added at final working concentration at 500 nM, 158 nM, 50 nM, 15.8 nM, 5 nM, 1.58 nM, 0.5 nM, 0.158 nM, 0.05 Nm, incubated for 3 days.
|
||||
| In Vitro Model | Mantle cell lymphoma | JeKo-1 cells | CVCL_1865 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
58.45 nM
|
|||
| Method Description |
ADCs were tested in HT-29 cells, and were added at final working concentration at 2000 nM, 500 nM, 250 nM, 125 nM, 62.5 nM, 31.25 nM, 15.625 nM, 7.813 nM, 1.953 nM, incubated for 4 days.
|
||||
| In Vitro Model | Colon adenocarcinoma | HT-29 cells | CVCL_0320 | ||
| Experiment 4 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
117.3 nM
|
|||
| Method Description |
ADCs were tested in NCI-H1944 cells, and were added at final working concentration at 500 nM, 158 nM, 50 nM, 15.8 nM, 5 nM, 1.58 nM, 0.5 nM, 0.158 nM, 0.05 Nm, incubated for 3 days.
|
||||
| In Vitro Model | Lung adenocarcinoma | NCI-H1944 cells | CVCL_1508 | ||
| Experiment 5 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
280.6 nM
|
|||
| Method Description |
ADCs were tested in A549 cells, and were added at final working concentration at 2000 nM, 500 nM, 250 nM, 125 nM, 62.5 nM, 31.25 nM, 15.625 nM, 7.813 nM, 1.953 nM, incubated for 3 days.
|
||||
| In Vitro Model | Lung adenocarcinoma | A549 cells | CVCL_0023 | ||
KR1020250008730A ADC2 [Investigative]
Discovered Using Cell Line-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Tumor Growth lnhibition value (TGl) |
15.37%
|
|||
| Method Description |
A xenograft model derived from cell lines was established by unilateral subcutaneous injection of 1×10^6 HT-29 cells into female Balb/C nude mice. When the tumor volume reached approximately 100 mm^3, B31-H3L3-MMAE was administered at a dose of 2 mg/kg. The treatment was given twice a week for 4 weeks. The tumor inhibition rate was calculated at the end of the experiment.
Click to Show/Hide
|
||||
| In Vivo Model | HT-29-xenograft model | ||||
| Experiment 2 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Tumor Growth lnhibition value (TGl) |
16.05%
|
|||
| Method Description |
A xenograft model derived from cell lines was established by unilateral subcutaneous injection of 1×10^6 HT-29 cells into female Balb/C nude mice. When the tumor volume reached approximately 100 mm^3, B31-H3L3-MMAE was administered at a dose of 0.4 mg/kg. The treatment was given twice a week for 4 weeks. The tumor inhibition rate was calculated at the end of the experiment.
Click to Show/Hide
|
||||
| In Vivo Model | HT-29-xenograft model | ||||
| Experiment 3 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Tumor Growth lnhibition value (TGl) |
34.96%
|
|||
| Method Description |
A xenograft model derived from cell lines was established by injecting 1×10^7 Jeko cells subcutaneously into the left side of female Balb/C nude mice. When the tumor volume reached approximately 100 mm^3, B31-H3L3-MMAE at doses of 2.5 mg/kg and 3.5 mg/kg was administered on the 15th and 29th days respectively. The tumor inhibition rate was calculated at the end of the experiment.
Click to Show/Hide
|
||||
| In Vivo Model | Jeko-1-xenograft model | ||||
| Experiment 4 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Tumor Growth lnhibition value (TGl) |
43.98%
|
|||
| Method Description |
A xenograft model derived from cell lines was established by unilateral subcutaneous injection of 1×10^6 A549 cells into female Balb/C nude mice. When the tumor volume reached approximately 100 mm^3, B31-H3L3-MMAE was administered at a dose of 10 mg/kg. The treatment was given twice a week for 3 weeks. The tumor inhibition rate was calculated at the end of the experiment.
Click to Show/Hide
|
||||
| In Vivo Model | A549-xenograft model | ||||
| Experiment 5 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Tumor Growth lnhibition value (TGl) |
60.47%
|
|||
| Method Description |
A xenograft model derived from cell lines was established by injecting 1×10^7 Jeko cells subcutaneously into the left side of female Balb/C nude mice. When the tumor volume reached approximately 100 mm^3, B31-H3L3-MMAE was administered at a dose of 2.5 mg/kg. The treatment was given once a week for 3 weeks. The tumor inhibition rate was calculated at the end of the experiment.
Click to Show/Hide
|
||||
| In Vivo Model | Jeko-1-xenograft model | ||||
| Experiment 6 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Tumor Growth lnhibition value (TGl) |
79.24%
|
|||
| Method Description |
A xenograft model derived from cell lines was established by injecting 1×10^7 Jeko-1 cells subcutaneously into the left side of female Balb/C nude mice. When the tumor volume reached approximately 100 mm^3, B31-H3L3-MMAE was administered at a dose of 10 mg/kg once. The tumor inhibition rate was calculated at the end of the experiment.
|
||||
| In Vivo Model | Jeko-1-xenograft model | ||||
| Experiment 7 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Tumor Growth lnhibition value (TGl) |
79.79%
|
|||
| Method Description |
A xenograft model derived from the cell line was established by injecting 1×10^6 MDA-MB-231 cells subcutaneously into the left side of female Balb/C nude mice. When the tumor volume reached approximately 100 mm^3, B31-H3L3-MMAE was administered at a dose of 5 mg/kg. The treatment was given once a week for 3 weeks. The tumor inhibition rate was calculated at the end of the experiment.
Click to Show/Hide
|
||||
| In Vivo Model | MDA-MB-231-xenograft model | ||||
| Experiment 8 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Tumor Growth lnhibition value (TGl) |
85.53%
|
|||
| Method Description |
A xenograft model derived from cell lines was established by unilateral subcutaneous injection of 1×10^6 HT-29 cells into female Balb/C nude mice. When the tumor volume reached approximately 100 mm^3, B31-H3L3-MMAE was administered at a dose of 10 mg/kg. The treatment was given twice a week for 4 weeks. The tumor inhibition rate was calculated at the end of the experiment.
Click to Show/Hide
|
||||
| In Vivo Model | HT-29-xenograft model | ||||
| Experiment 9 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Tumor Growth lnhibition value (TGl) |
91.52%
|
|||
| Method Description |
A xenograft model derived from the cell line was established by injecting 1×10^6 NCI-N87 cells subcutaneously into the left side of female Balb/C nude mice. When the tumor volume reached approximately 100 mm^3, B31-H3L3-MMAE was administered at a dose of 5 mg/kg. The treatment was given once a week for 3 weeks. The tumor inhibition rate was calculated at the end of the experiment.
Click to Show/Hide
|
||||
| In Vivo Model | NCI-N87-xenograft model | ||||
| Experiment 10 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Tumor Growth lnhibition value (TGl) |
95.44%
|
|||
| Method Description |
A xenograft model derived from cell lines was established by injecting 1×10^7 Jeko cells subcutaneously into the left side of female Balb/C nude mice. When the tumor volume reached approximately 100 mm^3, B31-H3L3-MMAE was administered at a dose of 10 mg/kg. The treatment was given once a week for 3 weeks. The tumor inhibition rate was calculated at the end of the experiment.
Click to Show/Hide
|
||||
| In Vivo Model | Jeko-1-xenograft model | ||||
| Experiment 11 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Tumor Growth lnhibition value (TGl) |
96.60%
|
|||
| Method Description |
A xenograft model derived from the cell line was established by injecting 1×10^6 MDA-MB-231 cells subcutaneously into the left side of female Balb/C nude mice. When the tumor volume reached approximately 100 mm^3, B31-H3L3-MMAE was administered at a dose of 10 mg/kg. The treatment was given once a week for 3 weeks. The tumor inhibition rate was calculated at the end of the experiment.
Click to Show/Hide
|
||||
| In Vivo Model | MDA-MB-231-xenograft model | ||||
| Experiment 12 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Tumor Growth lnhibition value (TGl) |
98.02%
|
|||
| Method Description |
A xenograft model derived from the cell line was established by injecting 1×10^7 MDA-MB-468 cells subcutaneously into the left side of female Balb/C nude mice. When the tumor volume reached approximately 100 mm^3, B31-H3L3-MMAE was administered at a dose of 5 mg/kg. The treatment was given once a week for 4 weeks. The tumor inhibition rate was calculated at the end of the experiment.
Click to Show/Hide
|
||||
| In Vivo Model | MDA-MB-468-xenograft model | ||||
| Experiment 13 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Tumor Growth lnhibition value (TGl) |
99.31%
|
|||
| Method Description |
A xenograft model derived from the cell line was established by injecting 1×10^6 NCI-N87 cells subcutaneously into the left side of female Balb/C nude mice. When the tumor volume reached approximately 100 mm^3, B31-H3L3-MMAE was administered at a dose of 10 mg/kg. The treatment was given once a week for 3 weeks. The tumor inhibition rate was calculated at the end of the experiment.
Click to Show/Hide
|
||||
| In Vivo Model | NCI-N87-xenograft model | ||||
| Experiment 14 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Tumor Growth lnhibition value (TGl) |
100%
|
|||
| Method Description |
A xenograft model derived from the cell line was established by injecting 1×10^7 MDA-MB-468 cells subcutaneously into the left side of female Balb/C nude mice. When the tumor volume reached approximately 100 mm^3, B31-H3L3-MMAE was administered at a dose of 10 mg/kg. The treatment was given once a week for 4 weeks. The tumor inhibition rate was calculated at the end of the experiment.
Click to Show/Hide
|
||||
| In Vivo Model | MDA-MB-468-xenograft model | ||||
| Experiment 15 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Tumor Growth lnhibition value (TGl) |
100%
|
|||
| Method Description |
A xenograft model derived from cell lines was established by injecting 1×10^7 MDA-MB-468 cells subcutaneously into female BALB/C nude mice. When the tumor volume reached approximately 100 mm^3, B31-H3L3-MMAE was administered at a dose of 10 mg/kg once. The tumor inhibition rate was calculated at the end of the experiment.
|
||||
| In Vivo Model | MDA-MB-468-xenograft model | ||||
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC55) |
117.3 nM
|
|||
| Method Description |
NCI-H1944 cells were added with ADC samples, and the drug concentration gradient was diluted to 500, 158, 50, 15.8, 5, 1.58, 0.5, 0.158, and 0.05 nM. The cells were cultured at 37°C with 5% CO2 for 72 hours. Then, 10 uL of LCK8 (Bimake, B34304) was added to each well, and the cells were incubated at 37°C for 1 hour. The data were read at OD450 using a microplate reader.
Click to Show/Hide
|
||||
| In Vitro Model | Lung adenocarcinoma | NCI-H1944 cells | CVCL_1508 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC54) |
15.24 nM
|
|||
| Method Description |
MDA-MB-468 cells were added with ADC samples, and the drug concentration gradient was diluted to 500, 158, 50, 15.8, 5, 1.58, 0.5, 0.158, and 0.05 nM. The cells were cultured at 37°C with 5% CO2 for 72 hours. Then, 10 uL of LCK8 (Bimake, B34304) was added to each well, and the cells were incubated at 37°C for 1 hour. The data were read at OD450 using a microplate reader.
Click to Show/Hide
|
||||
| In Vitro Model | Breast adenocarcinoma | MDA-MB-468 cells | CVCL_0419 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC53) |
38.24 nM
|
|||
| Method Description |
Jeko-1 cells were co-cultured with ADC samples, and the drug concentration gradient was diluted to 500, 158, 50, 15.8, 5, 1.58, 0.5, 0.158, and 0.05 nM. The cells were cultured at 37°C with 5% CO2 for 72 hours. Then, 10 uL of LCK8 (Bimake, B34304) was added to each well, and the reaction was incubated at 37°C for 1 hour. The data were read at OD450 using a microplate reader.
Click to Show/Hide
|
||||
| In Vitro Model | Mantle cell lymphoma | JeKo-1 cells | CVCL_1865 | ||
References
