General Information of This Antibody
Antibody ID
ANTI0YPHEP
Antibody Name
Hu005-46
Organization
Hefei Institutes of Physical Science
Synonyms
Hu005-46
   Click to Show/Hide
Antibody Type
Monoclonal antibody (mAb)
Antigen Name
Inactive tyrosine-protein kinase transmembrane receptor ROR1 (ROR1)
 Antigen Info 
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Varible Domain
EVQLVESGGGLVKPGGSLRLSCAASGFTFNSYAMSWVRQTPGKRLEWVATISDAGSYTYY
PDNEKGRFTISRDNAKNSLYLQMNSLRAEDTAIYYCVRGGYYYNLYAMDYWGQGTLVTVS
S
    Click to Show/Hide
Light Chain Varible Domain
DIVLTQSPDSLAVSLGERATINCKASQSVSFPGTSLMHWYQQKPGQQPKLLIYRASNLEA
GVPDRFSGSGSRTDFTLTISSLQAEDVAVYYCQQSREYPWTFGGGTKVEIK
    Click to Show/Hide
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
Hu005-46-MMAE [Investigative]
Discovered Using Cell Line-derived Xenograft Model
Click To Hide/Show 6 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth lnhibition value (TGl)
39.72%
High ROR1 expression (ROR1 +++)
Method Description
Cell line-derived xenograft models were established the back of immunodeficient mice (NCG or Balb/c nude), by subcutaneous injection of 5x106 (PA-1) tumor cells, and treatmen with 2.5mg/kg ADC (via the tail vein, Qw&#423) after tumor volume about 100-300mm3. Determined tumor volume after the experiment, measured at day 21.
In Vivo Model NCI-N87 xenograft model
Experiment 2 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth lnhibition value (TGl)
59.85%
High ROR1 expression (ROR1 +++)
Method Description
Cell line-derived xenograft models were established the back of immunodeficient mice (NCG or Balb/c nude), by subcutaneous injection of 5x106 (MDA-MB-231) tumor cells, and treatmen with 2.5mg/kg ADC (via the tail vein, Qw&#423) after tumor volume about 100-300mm3. Determined tumor volume after the experiment, measured at day 28.

   Click to Show/Hide
In Vivo Model MDA-MB-231 xenograft model
Experiment 3 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth lnhibition value (TGl)
69.98%
High ROR1 expression (ROR1 +++)
Method Description
Cell line-derived xenograft models were established the back of immunodeficient mice (NCG or Balb/c nude), by subcutaneous injection of 1x107 (PA-1) tumor cells, and treatmen with 2.5mg/kg ADC (via the tail vein, Qw&#423) after tumor volume about 100-300mm3. Determined tumor volume after the experiment, measured at day 28.
In Vivo Model PA-1 xenograft model
Experiment 4 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth lnhibition value (TGl)
71.49%
High ROR1 expression (ROR1 +++)
Method Description
Cell line-derived xenograft models were established the back of immunodeficient mice (NCG or Balb/c nude), by subcutaneous injection of 5x106 (PA-1) tumor cells, and treatmen with 5mg/kg ADC (via the tail vein, Qw&#423) after tumor volume about 100-300mm3. Determined tumor volume after the experiment, measured at day 21.
In Vivo Model NCI-N87 xenograft model
Experiment 5 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth lnhibition value (TGl)
93.85%
High ROR1 expression (ROR1 +++)
Method Description
Cell line-derived xenograft models were established the back of immunodeficient mice (NCG or Balb/c nude), by subcutaneous injection of 5x106 (MDA-MB-231) tumor cells, and treatmen with 5mg/kg ADC (via the tail vein, Qw&#423) after tumor volume about 100-300mm3. Determined tumor volume after the experiment, measured at day 28.
In Vivo Model MDA-MB-231 xenograft model
Experiment 6 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth lnhibition value (TGl)
96.22%
High ROR1 expression (ROR1 +++)
Method Description
Cell line-derived xenograft models were established the back of immunodeficient mice (NCG or Balb/c nude), by subcutaneous injection of 1x107 (PA-1) tumor cells, and treatmen with 5mg/kg ADC (via the tail vein, Qw&#423) after tumor volume about 100-300mm3. Determined tumor volume after the experiment, measured at day 28.
In Vivo Model PA-1 xenograft model
Revealed Based on the Cell Line Data
Click To Hide/Show 11 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
1.64 nM
High ROR1 expression (ROR1 +++)
Method Description
A total of 250-1500cells (NCI-H446) were plated in 150ul cell culture medium per well of a 96-well flat plate in the appropriate growth media. After 3-5h, add ADC at different concentrations respectively. Set 2-4 replicate wells for each drug concentration, as well as corresponding vehicle control and blank control wells. After 5-6 days of treatment (according to the cell growth rate to ensure sufficient cell division), pour off the culture medium, add CCK8 reaction solution (purchased from MCE, cat#HY - K0301), 100 uL per well. Incubate at 37°C until the expected color intensity is reached, and measure the cell viability (OD450nm) of each group.

   Click to Show/Hide
In Vitro Model Lung small cell carcinoma NCI-H446 cells CVCL_1562
Experiment 2 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
2.45 nM
High ROR1 expression (ROR1 +++)
Method Description
A total of 250-1500cells (PA-1) were plated in 150ul cell culture medium per well of a 96-well flat plate in the appropriate growth media. After 3-5h, add ADC at different concentrations respectively. Set 2-4 replicate wells for each drug concentration, as well as corresponding vehicle control and blank control wells. After 5-6 days of treatment (according to the cell growth rate to ensure sufficient cell division), pour off the culture medium, add CCK8 reaction solution (purchased from MCE, cat#HY - K0301), 100 uL per well. Incubate at 37°C until the expected color intensity is reached, and measure the cell viability (OD450nm) of each group.

   Click to Show/Hide
In Vitro Model Ovarian mixed germ cell tumor PA-1 cells CVCL_0479
Experiment 3 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
4.11 nM
High ROR1 expression (ROR1 +++)
Method Description
A total of 250-1500cells (HCC1187) were plated in 150ul cell culture medium per well of a 96-well flat plate in the appropriate growth media. After 3-5h, add ADC at different concentrations respectively. Set 2-4 replicate wells for each drug concentration, as well as corresponding vehicle control and blank control wells. After 5-6 days of treatment (according to the cell growth rate to ensure sufficient cell division), pour off the culture medium, add CCK8 reaction solution (purchased from MCE, cat#HY - K0301), 100 uL per well. Incubate at 37°C until the expected color intensity is reached, and measure the cell viability (OD450nm) of each group.

   Click to Show/Hide
In Vitro Model Breast ductal carcinoma HCC1187 cells CVCL_1247
Experiment 4 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
4.28 nM
High ROR1 expression (ROR1 +++)
Method Description
A total of 250-1500cells (SK-CO-1) were plated in 150ul cell culture medium per well of a 96-well flat plate in the appropriate growth media. After 3-5h, add ADC at different concentrations respectively. Set 2-4 replicate wells for each drug concentration, as well as corresponding vehicle control and blank control wells. After 5-6 days of treatment (according to the cell growth rate to ensure sufficient cell division), pour off the culture medium, add CCK8 reaction solution (purchased from MCE, cat#HY - K0301), 100 uL per well. Incubate at 37°C until the expected color intensity is reached, and measure the cell viability (OD450nm) of each group.

   Click to Show/Hide
In Vitro Model Colon adenocarcinoma SKCO1 cells CVCL_0626
Experiment 5 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
5.65 nM
High ROR1 expression (ROR1 +++)
Method Description
A total of 250-1500cells (MDA-MB-231) were plated in 150ul cell culture medium per well of a 96-well flat plate in the appropriate growth media. After 3-5h, add ADC at different concentrations respectively. Set 2-4 replicate wells for each drug concentration, as well as corresponding vehicle control and blank control wells. After 5-6 days of treatment (according to the cell growth rate to ensure sufficient cell division), pour off the culture medium, add CCK8 reaction solution (purchased from MCE, cat#HY - K0301), 100 uL per well. Incubate at 37°C until the expected color intensity is reached, and measure the cell viability (OD450nm) of each group.

   Click to Show/Hide
In Vitro Model Breast adenocarcinoma MDA-MB-231 cells CVCL_0062
Experiment 6 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
6.41 nM
High ROR1 expression (ROR1 +++)
Method Description
A total of 250-1500cells (NCI-N87) were plated in 150ul cell culture medium per well of a 96-well flat plate in the appropriate growth media. After 3-5h, add ADC at different concentrations respectively. Set 2-4 replicate wells for each drug concentration, as well as corresponding vehicle control and blank control wells. After 5-6 days of treatment (according to the cell growth rate to ensure sufficient cell division), pour off the culture medium, add CCK8 reaction solution (purchased from MCE, cat#HY - K0301), 100 uL per well. Incubate at 37°C until the expected color intensity is reached, and measure the cell viability (OD450nm) of each group.

   Click to Show/Hide
In Vitro Model Gastric tubular adenocarcinoma NCI-N87 cells CVCL_1603
Experiment 7 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
12.13 nM
Moderate ROR1 expression (ROR1++)
Method Description
A total of 250-1500cells (COLO-678) were plated in 150ul cell culture medium per well of a 96-well flat plate in the appropriate growth media. After 3-5h, add ADC at different concentrations respectively. Set 2-4 replicate wells for each drug concentration, as well as corresponding vehicle control and blank control wells. After 5-6 days of treatment (according to the cell growth rate to ensure sufficient cell division), pour off the culture medium, add CCK8 reaction solution (purchased from MCE, cat#HY - K0301), 100 uL per well. Incubate at 37°C until the expected color intensity is reached, and measure the cell viability (OD450nm) of each group.

   Click to Show/Hide
In Vitro Model Colon carcinoma COLO-678 cells CVCL_1129
Experiment 8 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
13.48 nM
High ROR1 expression (ROR1 +++)
Method Description
A total of 250-1500cells (HCC827) were plated in 150ul cell culture medium per well of a 96-well flat plate in the appropriate growth media. After 3-5h, add ADC at different concentrations respectively. Set 2-4 replicate wells for each drug concentration, as well as corresponding vehicle control and blank control wells. After 5-6 days of treatment (according to the cell growth rate to ensure sufficient cell division), pour off the culture medium, add CCK8 reaction solution (purchased from MCE, cat#HY - K0301), 100 uL per well. Incubate at 37°C until the expected color intensity is reached, and measure the cell viability (OD450nm) of each group.

   Click to Show/Hide
In Vitro Model Lung adenocarcinoma HCC827 cells CVCL_2063
Experiment 9 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
19.11 nM
High ROR1 expression (ROR1 +++)
Method Description
A total of 250-1500cells (HT-29) were plated in 150ul cell culture medium per well of a 96-well flat plate in the appropriate growth media. After 3-5h, add ADC at different concentrations respectively. Set 2-4 replicate wells for each drug concentration, as well as corresponding vehicle control and blank control wells. After 5-6 days of treatment (according to the cell growth rate to ensure sufficient cell division), pour off the culture medium, add CCK8 reaction solution (purchased from MCE, cat#HY - K0301), 100 uL per well. Incubate at 37°C until the expected color intensity is reached, and measure the cell viability (OD450nm) of each group.

   Click to Show/Hide
In Vitro Model Colon adenocarcinoma HT-29 cells CVCL_0320
Experiment 10 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50) > 100 nM Positive ROR1 expression (ROR1+++/++)
Method Description
A total of 250-1500cells (SK-BR-3) were plated in 150ul cell culture medium per well of a 96-well flat plate in the appropriate growth media. After 3-5h, add ADC at different concentrations respectively. Set 2-4 replicate wells for each drug concentration, as well as corresponding vehicle control and blank control wells. After 5-6 days of treatment (according to the cell growth rate to ensure sufficient cell division), pour off the culture medium, add CCK8 reaction solution (purchased from MCE, cat#HY - K0301), 100 uL per well. Incubate at 37°C until the expected color intensity is reached, and measure the cell viability (OD450nm) of each group.

   Click to Show/Hide
In Vitro Model Breast adenocarcinoma SK-BR-3 cells CVCL_0033
Experiment 11 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50) > 100 nM Low ROR1 expression (ROR1+)
Method Description
A total of 250-1500cells (MCF-7) were plated in 150ul cell culture medium per well of a 96-well flat plate in the appropriate growth media. After 3-5h, add ADC at different concentrations respectively. Set 2-4 replicate wells for each drug concentration, as well as corresponding vehicle control and blank control wells. After 5-6 days of treatment (according to the cell growth rate to ensure sufficient cell division), pour off the culture medium, add CCK8 reaction solution (purchased from MCE, cat#HY - K0301), 100 uL per well. Incubate at 37°C until the expected color intensity is reached, and measure the cell viability (OD450nm) of each group.

   Click to Show/Hide
In Vitro Model Invasive breast carcinoma MCF-7 cells CVCL_0031
References
Ref 1 Antibodies specifically binding ROR1, their drug conjugates, preparation methods and uses