General Information of This Antibody (ID: ANTI0YKTOP)
Antibody Name
glembatumumab
Antigen Name
GPNMB
 Antigen Info 
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence
QVQLQESGPGLVKPSQTLSLTCTVSGGSISSFNYYWSWIRHHPGKGLEWIGYIYYSGSTY
SNPSLKSRVTISVDTSKNQFSLTLSSVTAADTAVYYCARGYNWNYFDYWGQGTLVTVSSA
STKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG
LYSLSSVVTVPSSNFGTQTYTCNVDHKPSNTKVDKTVERKCCVECPPCPAPPVAGPSVFL
FPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRV
VSVLTVVHQDWLNGKEYKCKVSNKGLPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQ
VSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSRWQQGNV
FSCSVMHEALHNHYTQKSLSLSPGK
    Click to Show/Hide
Heavy Chain Varible Domain
QVQLQESGPGLVKPSQTLSLTCTVSGGSISSFNYYWSWIRHHPGKGLEWIGYIYYSGSTY
SNPSLKSRVTISVDTSKNQFSLTLSSVTAADTAVYYCARGYNWNYFDYWGQGTLVTVSSA
STKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG
LYSLSSVVTVPSSNFGTQTYTCNVDHKPSNTKVDKTVERKCCVECPPCPAPPVAGPSVFL
FPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRV
VSVLTVVHQDWLNGKEYKCKVSNKGLPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQ
VSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSRWQQGNV
FSCSVMHEALHNHYTQKSLSLSPGK
    Click to Show/Hide
Light Chain Sequence
EIVMTQSPATLSVSPGERATLSCRASQSVDNNLVWYQQKPGQAPRLLIYGASTRATGIPA
RFSGSGSGTEFTLTISSLQSEDFAVYYCQQYNNWPPWTFGQGTKVEIKRTVAAPSVFIFP
PSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL
TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
    Click to Show/Hide
Light Chain Varible Domain
EIVMTQSPATLSVSPGERATLSCRASQSVDNNLVWYQQKPGQAPRLLIYGASTRATGIPA
RFSGSGSGTEFTLTISSLQSEDFAVYYCQQYNNWPPWTFGQGTKVEIKRTVAAPSVFIFP
PSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL
TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
    Click to Show/Hide
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
Glembatumumab vedotin [Phase 2 (discontinued)]
Identified from the Human Clinical Data
Click To Hide/Show 18 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Progression Free Survival
3.1 months
Patients Enrolled
Patients must have histologically or cytologically confirmed metastatic or locally recurrent uveal melanoma; because histologic or cytologic confirmation of primary uveal melanoma is not always possible, confirmation of the clinical diagnosis of uveal melanoma by the treating investigator is allowed; clinical diagnosis of uveal melanoma is often made by an ophthalmologist, not by tissue diagnosis; if an ophthalmologist diagnosed and treated a patient for uveal melanoma in the past, it is sufficient for a clinical diagnosis

   Click to Show/Hide
Administration Dosage
Patients receive glembatumumab vedotin IV over 90 minutes every 3 weeks in the absence of disease progression or unacceptable toxicity.
Related Clinical Trial
NCT Number NCT02363283  Clinical Status PHASE2
Clinical Description
A Phase 2 Study of CDX-011 (Glembatumumab Vedotin) for Metastatic Uveal Melanoma
Primary Endpoint
Overall Response Rate Using Response Evaluation Criteria in Solid Tumors Version 1.1.
Other Endpoint
The Number of Participants With Change in Glycoprotein NMB Expression on Tumor Tissue Via Immunohistochemistry, Progression-free Survival, Number of Participants With Grade 3-4 Adverse Events According to the National Cancer Institute Common Toxicity Criteria Version 4.0, Overall Survival.
Experiment 2 Reporting the Activity Date of This ADC [2]
Efficacy Data Progression Free Survival
9.1 weeks
Patients Enrolled
Females with confirmed breast cancer, Age ≥ 18 years, Eastern Cooperative Oncology Group (ECOG) Performance Status 0 to 2.
Administration Dosage
administered as an intravenous infusion on Day 1 of a 21 day cycle.
Related Clinical Trial
NCT Number NCT00704158  Clinical Status PHASE1|||PHASE2
Clinical Description
A Phase I/II Study of CR011-vcMMAE in Patients With Locally Advanced or Metastatic Breast Cancer
Primary Endpoint
To evaluate the safety and tolerability of CR011-vcMMAE in breast cancer patients [Time Frame: throughout the study];To determine the MTD of CR011-vcMMAE in breast cancer patients [Time Frame: throughout the study].
Other Endpoint
Evaluation of efficacy (progression-free survival rate at 12 weeks, objective response rate, time to response, duration of response and time to progression) [Time Frame: throughout the study].
Experiment 3 Reporting the Activity Date of This ADC [3]
Efficacy Data Partial Response (PR)
7.69%
Patients Enrolled
Male or female patients with metastatic, histologically- or cytologically-confirmed unresectable Stage IIIB or IV non-small cell lung cancer (NSCLC) of squamous histology (Staging per American Joint Committee on Cancer [AJCC], Edition 7). Mixed histology adenosquamous NSCLC will also be permitted.
Administration Dosage
Glembatumumab vedotin once every three weeks (q3w) by 90-minute intravenous (IV) infusion, until disease progression or intolerance. The Dose-Limiting Toxicity (DLT) evaluation period for determination of the appropriateness of dose-escalation will be through the end of the second treatment cycle.
Related Clinical Trial
NCT Number NCT02713828  Clinical Status PHASE1|||PHASE2
Clinical Description
A Phase I/II Study of Glembatumumab Vedotin in Patients With gpNMB-Expressing, Advanced or Metastatic Squamous Cell Carcinoma of the Lung
Primary Endpoint
Phase I: Determine Maximum Tolerated Dose (MTD) [Time Frame: 42 (±3) days];Phase II: Objective Response Rate (ORR) [Time Frame: 40 months].
Other Endpoint
Number of Participants With Treatment-related Adverse Events as Assessed by CTCAE v4.0., Duration of Objective Response (DOR) [Time Frame: 23 months], Progression-Free Survival (PFS) [Time Frame: 23 months], Overall Survival (OS) [Time Frame: 23 months].
Experiment 4 Reporting the Activity Date of This ADC [1]
Efficacy Data Overall suvival (OS)
11.9 months
Patients Enrolled
Patients must have histologically or cytologically confirmed metastatic or locally recurrent uveal melanoma; because histologic or cytologic confirmation of primary uveal melanoma is not always possible, confirmation of the clinical diagnosis of uveal melanoma by the treating investigator is allowed; clinical diagnosis of uveal melanoma is often made by an ophthalmologist, not by tissue diagnosis; if an ophthalmologist diagnosed and treated a patient for uveal melanoma in the past, it is sufficient for a clinical diagnosis

   Click to Show/Hide
Administration Dosage
Patients receive glembatumumab vedotin IV over 90 minutes every 3 weeks in the absence of disease progression or unacceptable toxicity.
Related Clinical Trial
NCT Number NCT02363283  Clinical Status PHASE2
Clinical Description
A Phase 2 Study of CDX-011 (Glembatumumab Vedotin) for Metastatic Uveal Melanoma
Primary Endpoint
Overall Response Rate Using Response Evaluation Criteria in Solid Tumors Version 1.1.
Other Endpoint
The Number of Participants With Change in Glycoprotein NMB Expression on Tumor Tissue Via Immunohistochemistry, Progression-free Survival, Number of Participants With Grade 3-4 Adverse Events According to the National Cancer Institute Common Toxicity Criteria Version 4.0, Overall Survival.
Experiment 5 Reporting the Activity Date of This ADC [4]
Efficacy Data Objective Response Rate (ORR)
6%
Patients Enrolled
18 years of age or older.Locally advanced or metastatic breast cancer.Previous treatment with at least two but no more than seven prior chemotherapy treatments for progressive, recurrent or metastatic breast cancer.Unless not a candidate for these agents, prior therapies must have included a taxane, an anthracycline, and capecitabine, as well as trastuzumab and lapatinib for patients whose tumors are positive for the human epidermal growth factor receptor 2 (HER2). (Patients who received incomplete courses of therapy with these agents due to intolerance will be eligible.)Breast cancer tumor confirmed to express GPNMB. This will be determined by submitting a tissue sample (obtained during a diagnostic biopsy or surgery) to a central laboratory for analysis.

   Click to Show/Hide
Administration Dosage
CDX-011 (1.88 mg/kg) administered as an intravenous infusion on Day 1 of each 21 day cycle.
Related Clinical Trial
NCT Number NCT01156753  Clinical Status PHASE2
Clinical Description
The main purpose of this study is to see whether CDX-011 is effective in treating patients who have advanced breast cancer that makes a protein called glycoprotein NMB (GPNMB), and who have already received (or were not candidates for) all available approved therapies for their breast cancer. This study will also further characterize the safety of CDX-011 treatment in this patient population.

   Click to Show/Hide
Primary Endpoint
Glembatumumab vedotin was well tolerated as compared with IC chemotherapy (less hematologic toxicity; more rash, pruritus, neuropathy, and alopecia). ORR was 6% (five of 83) for glembatumumab vedotin versus 7% (three of 41) for IC, without significant intertreatment differences for predefined strata. Secondary end point revealed ORR of 12% (10 of 83) versus 12% (five of 41) overall, and 30% (seven of 23) versus 9% (one of 11) for gpNMB overexpression (≥ 25% of tumor cells). Unplanned analysis showed ORR of 18% (five of 28) versus 0% (0 of 11) in patients with triple-negative breast cancer (TNBC), and 40% (four of 10) versus 0% (zero of six) in gpNMB-overexpressing TNBC.

   Click to Show/Hide
Other Endpoint
In the breast cancer study, this dose resulted in an ORR of 12% (four of 33) and median progression-free survival (PFS) of 2.1 months. In the subset of patients with triple-negative breast cancer (TNBC), defined by the lack of overexpression of estrogen, progesterone, and human epidermal growth factor receptor 2 (HER2), ORR was 20% (two of 10), and median PFS was 4.1 months. For the small subset of patients with TNBC who also had gpNMB-expressing tumors (≥ 5% of epithelial or stromal cells were positive), ORR was 25% (one of four), and median PFS was 5.1 months..

   Click to Show/Hide
Experiment 6 Reporting the Activity Date of This ADC [5]
Efficacy Data Objective Response Rate (ORR)
11.00
21.00
7.00 %
Patients Enrolled
Unresectable, histologically-confirmed advanced (Stage III or Stage IV) melanoma.Disease progression during or after the last anticancer therapy received. For Cohort 3, progression must have occurred during the PD-1 targeted CPI (checkpoint inhibitor) treatment and the investigator has deemed it appropriate to continue treatment with the PD-1 targeted CPI beyond confirmed disease progression. No more than one prior chemotherapy-containing regimen for advanced disease. Prior treatments received must include at least one CPI inhibitor (e.g., anti-CTLA-4, PD-1-, PD-L1-targeted immunotherapy) and for patients with a BRAF mutation at least one BRAF- or MEK-targeted therapy, unless patients are not candidates for, or refused, these therapies. For cohort 3, prior treatment received must include a PD-1 targeted CPI administered during the most recent disease progression and for patients with BRAF mutation at least one BRAF- or MEK-targeted therapy when appropriate. The study site will submit paraffin-embedded tumor tissue obtained from the patient for gpNMB analysis. Patients may require a biopsy if recent tumor tissue is not available. Patients in cohort 2 and 3 must submit a recently obtained biopsy of the skin fold for gpNMB analysis. Patients in Cohort 4 will submit a tumor tissue sample while on study. Eastern Cooperative Oncology Group (ECOG) Performance Status 0 to 1. Adequate bone marrow, liver and renal function.

   Click to Show/Hide
Administration Dosage
glembatumumab vedotin administered as an intravenous infusion on Day 1 of each 21 day cycle.
Related Clinical Trial
NCT Number NCT02302339  Clinical Status PHASE2
Clinical Description
A Phase 2 Study of Glembatumumab Vedotin, an Anti-gpNMB Antibody-drug Conjugate, as Monotherapy or in Combination With Immunotherapies in Patients With Advanced Melanoma
Primary Endpoint
The ORR was 11.00% and the median response duration was 6.00 months (95% confidence interval [CI],4.10 months to not reached). The median PFS was 4.40 months (95% CI,2.60-5.50 months),and the median OS was 9.00 months (95% CI,6.10-11.70 months).
Other Endpoint
For patients who developed rash during the first cycle versus those who did not,the ORR was 21.00% versus 7.00%, respectively, and there was an overall improvement in PFS (hazard ratio,0.43; P = 0.013) and OS (hazard ratio,0.43; P = 0.017).
Experiment 7 Reporting the Activity Date of This ADC [2]
Efficacy Data Objective Response Rate (ORR)
12%
Patients Enrolled
Females with confirmed breast cancer, Age ≥ 18 years, Eastern Cooperative Oncology Group (ECOG) Performance Status 0 to 2.
Administration Dosage
administered as an intravenous infusion on Day 1 of a 21 day cycle.
Related Clinical Trial
NCT Number NCT00704158  Clinical Status PHASE1|||PHASE2
Clinical Description
A Phase I/II Study of CR011-vcMMAE in Patients With Locally Advanced or Metastatic Breast Cancer
Primary Endpoint
To evaluate the safety and tolerability of CR011-vcMMAE in breast cancer patients [Time Frame: throughout the study];To determine the MTD of CR011-vcMMAE in breast cancer patients [Time Frame: throughout the study].
Other Endpoint
Evaluation of efficacy (progression-free survival rate at 12 weeks, objective response rate, time to response, duration of response and time to progression) [Time Frame: throughout the study].
Experiment 8 Reporting the Activity Date of This ADC [1]
Efficacy Data Objective Response Rate (ORR)
51.40%
Patients Enrolled
Patients must have histologically or cytologically confirmed metastatic or locally recurrent uveal melanoma; because histologic or cytologic confirmation of primary uveal melanoma is not always possible, confirmation of the clinical diagnosis of uveal melanoma by the treating investigator is allowed; clinical diagnosis of uveal melanoma is often made by an ophthalmologist, not by tissue diagnosis; if an ophthalmologist diagnosed and treated a patient for uveal melanoma in the past, it is sufficient for a clinical diagnosis

   Click to Show/Hide
Administration Dosage
Patients receive glembatumumab vedotin IV over 90 minutes every 3 weeks in the absence of disease progression or unacceptable toxicity.
Related Clinical Trial
NCT Number NCT02363283  Clinical Status PHASE2
Clinical Description
A Phase 2 Study of CDX-011 (Glembatumumab Vedotin) for Metastatic Uveal Melanoma
Primary Endpoint
Overall Response Rate Using Response Evaluation Criteria in Solid Tumors Version 1.1.
Other Endpoint
The Number of Participants With Change in Glycoprotein NMB Expression on Tumor Tissue Via Immunohistochemistry, Progression-free Survival, Number of Participants With Grade 3-4 Adverse Events According to the National Cancer Institute Common Toxicity Criteria Version 4.0, Overall Survival.
Experiment 9 Reporting the Activity Date of This ADC [6]
Patients Enrolled
The patient has histologically confirmed, gpNMB expressing, metastatic triple-negative breast cancer.
Related Clinical Trial
NCT Number NCT03067935  Clinical Status N.A.
Clinical Description
N.A.
Experiment 10 Reporting the Activity Date of This ADC [7]
Patients Enrolled
Patients diagnosed with triple negative breast cancer, (stages II-III, or high risk T1c disease) found to have gpNMB expression at or above 25%), and who are appropriate candidates for neo-adjuvant therapy. Patients must be willing to undergo lumpectomy (with radiation therapy) or mastectomy following neo-adjuvant therapy.
Administration Dosage
Standard neo-adjuvant dose-dense doxorubicin 60 mg/m2 and Cytoxan 600 mg/m2 IV every 14 days for 4 cycles followed by GV 1.9 mg/kg IV every 21 days for 4 cycles.
Related Clinical Trial
NCT Number NCT03473691  Clinical Status EARLY_PHASE1
Clinical Description
Pilot Study of the Antibody-drug Conjugate Glembatumumab Vedotin (CDX-011) Following Doxorubicin (Adriamycin) and Cytoxan as Neo-adjuvant Therapy in Glycoprotein NMB-expressing High Risk Triple Negative Breast Cancer
Primary Endpoint
Incidence of Adverse Events (AEs), Proportion of patients who complete the 4 cycles of GV within 15 weeks of the first dose of GV (without dose limiting adverse events)., Number of discontinuations due to AEs.
Other Endpoint
Efficacy, Growth Differentiation Factor-11 (GDF11) expression in the tumor, Glycoprotein-NMB (gpNMB) expression in the tumor.
Experiment 11 Reporting the Activity Date of This ADC [8]
Patients Enrolled
Diagnosed with metastatic (i.e., cancer that has spread) TNBC, Documented progression of disease based on radiographic, clinical or pathologic, Breast cancer tumor confirmed to express gpNMB.
Administration Dosage
CDX-011 administered as an intravenous infusion on Day 1 of each 21 day cycle.
Related Clinical Trial
NCT Number NCT01997333  Clinical Status PHASE2
Clinical Description
A Randomized Multicenter Pivotal Study of CDX-011 (CR011-vcMMAE)in Patients With Metastatic, gpNMB Over-Expressing, Triple Negative Breast Cancer (The METRIC Study)
Primary Endpoint
Progression Free Survival (PFS)
Other Endpoint
Objective Response Rate (ORR), Duration of Response, verall Survival, Adverse Events (AE), Pharmacokinetics (PK).
Experiment 12 Reporting the Activity Date of This ADC [9]
Patients Enrolled
Patients must have histologically confirmed malignancy that is metastatic or unresectable and for which standard curative measures do not exist or are no longer effective. For TNBC and solid tumors other than melanoma: GPNMB expression as defined by at least 25% of malignant epithelial cells or tumor stromal cells expression GPNMB at any intensity via central immunohistochemistry on archived or biopsied tumor tissue (as per standard clinical care) from an advanced/metastatic disease site; for melanoma or uveal melanoma cohort: GPNMB testing results will not be required for eligibility assessment.

   Click to Show/Hide
Administration Dosage
Patients receive glembatumumab vedotin IV over 90 minutes and nivolumab IV over 60 minutes on day 8 of course 1 and on day 1 of subsequent courses. Patients in melanoma expanded cohort also receive ipilimumab IV over 90 minutes on day 1. Treatment with ipilimumab repeats every 21 days for 4 courses in the absence of disease progression or unaccepted toxicity and courses with glembatumumab vedotin and nivolumab repeat every 21 days in the absence of disease progression or unaccepted toxicity.

   Click to Show/Hide
Related Clinical Trial
NCT Number NCT03326258  Clinical Status PHASE1|||PHASE2
Clinical Description
Phase Ib/II Clinical Trial of Glembatumumab Vedotin and Nivolumab in Advanced Solid Tumors
Primary Endpoint
Recommended phase 2 dose for the combination of glembatumumab vedotin and nivolumab (Phase Ib), Antitumor activity measured by Immune-Modified Response Evaluation Criteria in Solid Tumors (iRECIST)/Response Evaluation Criteria in Solid Tumors (RECIST) 1.1 (Phase II)
Other Endpoint
Incidence of adverse events, Overall response rate, Clinical benefit rate, Progression free survival, Pharmacokinetic parameters, Levels of plasma and tissue biomarkers.
Experiment 13 Reporting the Activity Date of This ADC [10]
Patients Enrolled
Patients must have had histologic verification of osteosarcoma at original diagnosis or relapse, Patients must have measurable disease according to RECIST 1.1, and have relapsed or become refractory to conventional therapy, Patient must have archival tumor specimen available for submission, Patients must have a performance status corresponding to Eastern Cooperative Oncology Group (ECOG) scores of 0, 1 or 2; use Karnofsky for patients > 16 years of age and Lansky for patients =< 16 years of age.

   Click to Show/Hide
Administration Dosage
Patients receive glembatumumab vedotin IV over 90 minutes on day 1. Treatment repeats every 21 days for up to 18 courses in the absence of disease progression or unacceptable toxicity.
Related Clinical Trial
NCT Number NCT02487979  Clinical Status PHASE2
Clinical Description
A Phase 2 Study of GPNMB-Targeted Antibody-Drug Conjugate, CDX-011 (Glembatumumab Vedotin, CR011-vcMMAE; NSC# 763737), in Recurrent or Refractory Osteosarcoma
Primary Endpoint
Disease Control Success.
Other Endpoint
Twenty-two patients were enrolled, and all were evaluable for response. Antibody-drug conjugate levels were detectable in patients, although small numbers limit comparison to adult data. The toxicities observed were similar to the previous studies with GV. The most common grade III adverse event was rash. One death from end organ failure occurred possibly related to GV. Of the 22 patients, one patient had a partial response, and two had stable disease. There was no correlation between gpNMB expression and response to GV.

   Click to Show/Hide
Experiment 14 Reporting the Activity Date of This ADC [11]
Related Clinical Trial
NCT Number NCT06813417  Clinical Status NA
Clinical Description
An Open Label Individual Patient Dose Escalation Study Investigating the Safety and Efficacy of Retreatment with GCAR1 in a Patient with Multiply Relapsed Alveolar Soft Part Sarcoma
Experiment 15 Reporting the Activity Date of This ADC [12]
Efficacy Data Partial Response (PR)
7.69%
Patients Enrolled
Stage IIIB or IV squamous (or mixed adenosquamous) lung cancer measurable by Response Evaluation Criteria in Solid Tumors (RECIST 1.1).
Administration Dosage
A dose of 1.90 mg/kg as a 90-minute intravenous infusion for the escalation phase, on the basis of previous clinical trial results using glembatumumab vedotin at 1.3 mg/kg one-dose level; every 3 weeks.
Related Clinical Trial
NCT Number NCT02713828  Clinical Status Phase 1
Clinical Description
A phase 1/2 study of glembatumumab vedotin in patients with gpNMB-expressing, advanced or metastatic squamous cell carcinoma of the lung.
Primary Endpoint
To further characterize the safety of this drug, the protocol was modified and additional three patients were added to cohort 1 for a total of nine patients at 1.90 mg/kg dose. A second DLT was observed in cohort 1. The patient experienced grade 3 treatment-related pruritus requiring hospital admission. The dose was de-escalated to dose level 1. No DLT was observed at dose level 1 of 1.30 mg/kg.

   Click to Show/Hide
Other Endpoint
The best objective response per RECIST 1.1 was of one patient who achieved a partial response (1 of 13 [7.69%], 90% CI: 0.40%-31.60%).The median OS in this heavily pretreated population was 5.70 months (90% CI: 2.50-16.80). All patients had disease progression or died. The median PFS was 2.50 months (90% CI: 1.60-5.30).
Experiment 16 Reporting the Activity Date of This ADC [13]
Efficacy Data Objective Response Rate (ORR)
11.00
21.00
7.00 %
Patients Enrolled
Stage III or IV, histologically confirmed melanoma. Patients must had previously received no more than one prior chemotherapy-containing treatment regimen for advanced disease, at least one checkpoint inhibitor (ie, antiCTLA-4, PD-1, PD-L1targeted immunotherapy), and at least one BRAF-targeted and/or MEK-targeted therapy if melanoma harbored a BRAFV600 mutation, unless it was not clinically indicated or was refused by the patient.

   Click to Show/Hide
Administration Dosage
As a 90-minute intravenous infusion every 3 weeks at a starting dose of 1.90 mg/kg. Dose reductions to 1.30 and 1.00 mg/kg were allowed for toxicity.
Related Clinical Trial
NCT Number NCT02302339  Clinical Status Phase 2
Clinical Description
A phase 2 study of glembatumumab vedotin, an anti-gpNMB antibody-drug conjugate, as monotherapy or in combination with immunotherapies in patients with advanced melanoma.
Primary Endpoint
The ORR was 11.00% and the median response duration was 6.00 months (95% confidence interval [CI],4.10 months to not reached). The median PFS was 4.40 months (95% CI,2.60-5.50 months),and the median OS was 9.00 months (95% CI,6.10-11.70 months).
Other Endpoint
For patients who developed rash during the first cycle versus those who did not,the ORR was 21.00% versus 7.00%, respectively, and there was an overall improvement in PFS (hazard ratio,0.43; P = 0.013) and OS (hazard ratio,0.43; P = 0.017).
Experiment 17 Reporting the Activity Date of This ADC [14]
Efficacy Data Objective Response Rate (ORR)
12.00
18.00 %
Patients Enrolled
Locally advanced or metastatic carcinoma of the breast, progressive within 6 months of last therapy; received at least two prior chemotherapeutic regimens for breast cancer, with at least one given in the locally advanced or metastatic setting.
Administration Dosage
Glembatumumab vedotin was administered as a 90 minute intravenous infusion, once every 3 weeks (day 1 of repeated 21 day cycles). Delays of up to 3 weeks and up to two dose reductions (to dose levels of 1.34, 1.00, and 0.75 mg/kg, as applicable) were permitted for toxicity. Dosing continued until unmanageable treatment-related toxicities, disease progression, or death.

   Click to Show/Hide
Experiment 18 Reporting the Activity Date of This ADC [15]
Related Clinical Trial
NCT Number NCT01156753  Clinical Status Phase 2
Clinical Description
A phase 2, randomized, multicenter study of CDX-011 (CR011-vcMMAE) in patients with advanced GPNMB-expressing breast cancer.
Discovered Using Cell Line-derived Xenograft Model
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [16]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 93.33% High GPNMB expression (GPNMB+++)
Method Description
Tumor xenografts were generated by injecting UOK124 cells subcutaneously into flanks of athymic nude mice. Mice were randomized into treatment groups (n = 10 mice/group) based on tumor volume and treated with the following agents, singly or in combination CDX-011.
In Vivo Model UOK124 CDX model
In Vitro Model Papillary renal cell carcinoma UOK124 cells CVCL_B105
References
Ref 1 Glembatumumab Vedotin in Treating Patients With Metastatic or Locally Recurrent Uveal Melanoma
Ref 2 Study of CR011-vcMMAE to Treat Locally Advanced or Metastatic Breast Cancer
Ref 3 Study of Glembatumumab Vedotin in gpNMB-Expressing, Advanced or Metastatic SCC of the Lung
Ref 4 A Study of CDX-011 (CR011-vcMMAE) in Patients With Advanced GPNMB-expressing Breast Cancer
Ref 5 A Study of Glembatumumab Vedotin as Monotherapy or in Combination With Immunotherapies in Patients With Advanced Melanoma
Ref 6 Individual Patient Expanded Access-Glembatumumab Vedotin
Ref 7 Pilot Study of Glembatumumab Vedotin Following Doxorubicin and Cytoxan as Neo-adjuvant Therapy in Gp-NMB-expressing High Risk Triple Negative Breast Cancer
Ref 8 Study of Glembatumumab Vedotin (CDX-011) in Patients With Metastatic, gpNMB Over-Expressing, Triple Negative Breast Cancer
Ref 9 Glembatumumab Vedotin, Nivolumab, and Ipilimumab in Treating Patients With Advanced Metastatic Solid Tumors That Cannot Be Removed by Surgery
Ref 10 Glembatumumab Vedotin in Treating Patients With Recurrent or Refractory Osteosarcoma
Ref 11 CAR T Therapy with GCAR1 for Relapsed Alveolar Soft Part Sarcoma
Ref 12 Efficacy and Safety of Glembatumumab Vedotin in Patients With Advanced or Metastatic Squamous Cell Carcinoma of the Lung (PrECOG 0504). JTO Clin Res Rep. 2021 Mar 24;2(5):100166.
Ref 13 A phase 2 study of glembatumumab vedotin, an antibody-drug conjugate targeting glycoprotein NMB, in patients with advanced melanoma. Cancer. 2019 Apr 1;125(7):1113-1123.
Ref 14 Phase I/II study of the antibody-drug conjugate glembatumumab vedotin in patients with locally advanced or metastatic breast cancer. J Clin Oncol. 2014 Nov 10;32(32):3619-25.
Ref 15 EMERGE: A Randomized Phase II Study of the Antibody-Drug Conjugate Glembatumumab Vedotin in Advanced Glycoprotein NMB-Expressing Breast Cancer. J Clin Oncol. 2015 May 10;33(14):1609-19.
Ref 16 High-throughput and targeted drug screens identify pharmacological candidates against MiT-translocation renal cell carcinoma. J Exp Clin Cancer Res. 2023 Apr 25;42(1):99. doi: 10.1186/s13046-023-02667-4.