General Information of This Antibody (ID: ANTI0XKUPF)
Antibody Name
Trz-HC:p67
Organization
Technical University of Darmstadt.
Synonyms
Trz-HC:p67
   Click to Show/Hide
Antibody Type
Fusion protein (FP)
Antigen Name
Receptor tyrosine-protein kinase erbB-2 (ERBB2)
 Antigen Info 
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVARIYPTNGYTRY
ADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSS
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS
GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPPKSCDKTHTCPPCPAPELLG
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY
NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRD
ELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
WQQGNVFSCSVMHEALHNHYTQKSLSLSPGLRSPMPGVVVAVSVKPGDAVAEGQEICVIE
AMKMQNSMTAGKTGTVKSVHCQAGDTVGEGDLLVELE
    Click to Show/Hide
Light Chain Sequence
DIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYSASFLYSGVPS
RFSGSRSGTDFTLTISSLQPEDFATYYCQQHYTTPPTFGQGTKVEIKRTVAAPSVFIFPP
SDECLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
    Click to Show/Hide
The Activity Data of This Antibody
Antibody Activity Information 1 [1]
Half Maximal Effective Concentration (EC50)
4.6
nM
SK-BR-3 cells CVCL_0033 
Antigen Expression Positive HER2 expression (HER2+++/++)
Antibody Function Trz-HC:p67 bound to SK-BR-3 cells
Antibody Antigen Binding Assay EC50 values derived from cellular binding assays on SK-BR-3 cells.
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
Trz-HC:p67-MMAE [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 3 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Effective Concentration (EC50)
1.7 nM
Positive HER2 expression (HER2+++/++)
Method Description
6000 cells/well were seeded in a U bottom 96 well plate in 90 uL of medium (Table S 2) and incubated over night at 37 °C and 5% CO2. Jurkat cells utilized for this assay were derived from mechanism-of-action (MOA)-based bioassay core kit to measure FcGammaRIIIa (V158) function (Promega GmbH, Walldorf, Germany). The next day, 10 uL of a dilution row of each sample was added and cells were incubated for 3 days at 37°C and 5% CO2. To evaluate viability, cellular viability assay was performed utilizing CellTiter-Blue® (Promega GmbH, Walldorf, Germany) following the instructions if the supplier. Fluorescence measurement was conducted with a CLARIOstar Plus (BMG Labtech, Ortenberg, Germany) plate reader. Experiments with SKBR3, A431 and Ramos were conducted in at least two biological replicates with three technical replicates each. Assays on Jurkat cells were performed in technical triplicates.

   Click to Show/Hide
In Vitro Model Breast adenocarcinoma SK-BR-3 cells CVCL_0033
Experiment 2 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Effective Concentration (EC50)
3 nM
Negative HER2 expression (HER2-)
Method Description
6000 cells/well were seeded in a U bottom 96 well plate in 90 uL of medium (Table S 2) and incubated over night at 37 °C and 5% CO2. Jurkat cells utilized for this assay were derived from mechanism-of-action (MOA)-based bioassay core kit to measure FcGammaRIIIa (V158) function (Promega GmbH, Walldorf, Germany). The next day, 10 uL of a dilution row of each sample was added and cells were incubated for 3 days at 37°C and 5% CO2. To evaluate viability, cellular viability assay was performed utilizing CellTiter-Blue® (Promega GmbH, Walldorf, Germany) following the instructions if the supplier. Fluorescence measurement was conducted with a CLARIOstar Plus (BMG Labtech, Ortenberg, Germany) plate reader. Experiments with SKBR3, A431 and Ramos were conducted in at least two biological replicates with three technical replicates each. Assays on Jurkat cells were performed in technical triplicates.

   Click to Show/Hide
In Vitro Model Adenocarcinoma of the rat mammary gland Jurkat Fc-GammaIIIa++ cells CVCL_3475
Experiment 3 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Effective Concentration (EC50)
5.5 nM
Low HER2 expression (HER2+)
Method Description
6000 cells/well were seeded in a U bottom 96 well plate in 90 uL of medium (Table S 2) and incubated over night at 37 °C and 5% CO2. Jurkat cells utilized for this assay were derived from mechanism-of-action (MOA)-based bioassay core kit to measure FcGammaRIIIa (V158) function (Promega GmbH, Walldorf, Germany). The next day, 10 uL of a dilution row of each sample was added and cells were incubated for 3 days at 37°C and 5% CO2. To evaluate viability, cellular viability assay was performed utilizing CellTiter-Blue® (Promega GmbH, Walldorf, Germany) following the instructions if the supplier. Fluorescence measurement was conducted with a CLARIOstar Plus (BMG Labtech, Ortenberg, Germany) plate reader. Experiments with SKBR3, A431 and Ramos were conducted in at least two biological replicates with three technical replicates each. Assays on Jurkat cells were performed in technical triplicates.

   Click to Show/Hide
In Vitro Model Skin squamous cell carcinoma A431 cells CVCL_0037
References
Ref 1 A Recognition Tag of Human Origin for Bioorthogonal Generation of Antibody-Drug Conjugates using Microbial Biotin Ligase