General Information of This Antibody
Antibody ID
ANTI0XDRGN
Antibody Name
Anti-Nectin-4 antibody
Antigen Name
Nectin-4 (NECTIN4)
 Antigen Info 
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFTFSNYGMAWVRQAPGKGLEWVSFISNLAYIGIN
YADTVTGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARGARATGWFAYWGQGTLVTVSS
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS
GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGG
PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN
STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREE
MTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSRW
QQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    Click to Show/Hide
Light Chain Sequence
DIQMTQSPSSLSASVGDRVTITCKASQNVDTHVAWYQQKPGKAPKALIYSASYRYSGVPS
RFSGSGSGTDFTLTISSLQPEDFATYYCQQYNSYPLTFGGGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
    Click to Show/Hide
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
LY4101174 [Phase 1]
Identified from the Human Clinical Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Patients Enrolled
Eligible patients have specified advanced solid tumors (urothelial, TNBC, NSCLC, etc.) with disease progression after prior therapies (requirements vary by cohort). Key requirements include ECOG 0-1, measurable disease (except Cohort A1), and available tumor tissue. Exclusion criteria include CNS metastases, uncontrolled comorbidities (hypercalcemia, diabetes), corneal disease, recent thromboembolic events, QTcF ≥470ms, or active infections.

   Click to Show/Hide
Related Clinical Trial
NCT Number NCT06238479  Clinical Status PHASE1
Clinical Description
A Phase 1 Trial Investigating LY4101174, an Antibody-Drug Conjugate Targeting Nectin-4, in Participants With Recurrent, Advanced or Metastatic Solid Tumors
Primary Endpoint
The Phase 1a primary objective is to establish LY4101174's recommended dose based on dose-limiting toxicities (DLTs) observed within the first two 28-day cycles. Phase 1b evaluates antitumor activity through overall response rate (ORR) as per RECIST 1.1 criteria over approximately 4 years.
Other Endpoint
Pharmacokinetic analysis assesses minimum plasma concentration (Cmin) and area under curve (AUC) during initial treatment cycles (56 days). Antitumor evaluation includes multiple efficacy measures: ORR, duration of response (DOR), time to response (TTR), progression-free survival (PFS), disease control rate (DCR) and overall survival (OS) - all assessed per RECIST 1.1 over ~4 years.

   Click to Show/Hide
References
Ref 1 A Study of LY4101174 in Participants With Recurrent, Advanced or Metastatic Solid Tumors