Antibody Information
General Information of This Antibody (ID: ANTI0TYDEL)
| Antibody Name | A humanized anti-c-MET IgG2 mAb |
|||||
|---|---|---|---|---|---|---|
| Antigen Name | Hepatocyte growth factor receptor (MET) |
Antigen Info | ||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Sequence |
QVQLVESGGGVVQPGRSLRLSCAASGFSLSNYGVHWVRQAPGKGLEWLAVIWSGGSTNYA
AAFVSRLTISKDNSKNTVYLQMNSLRAEDTAVYYCARHHDNPYNYAMDYWGQGTTVTVSS ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS GLYSLSSVVTVPSSNFGTQTYTCNVDHKPSNTKVDKTVERKCCVECPPCPAPPVAGPSVF LFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFR VVSVLTVVHQDWLNGKEYKCKVSNKGLPAPIEKTISKTKGQPREPQVYTLPPSREEMTKN QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSRWQQGN VFSCSVMHEALHNHYTQKSLSLSPGK Click to Show/Hide
|
|||||
| Light Chain Sequence |
DIVLTQSPDSLAVSLGERATINCRADKSVSTSTYNYLHWYQQKPGQPPKLLIYLASNLAS
GVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQHSRDLPPTFGQGTKLEIKRTVAAPSVF IFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLS STLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Click to Show/Hide
|
|||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
SHR-1826 [Phase 2]
Identified from the Human Clinical Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Patients Enrolled |
Eligible NSCLC patients aged 18-75 with ECOG 0-1, measurable lesions (RECIST v1.1), and adequate organ function must provide tumor tissue. Excluded are those with CNS metastasis, recent major surgery, unresolved toxicities (>CTCAE v5.0 Grade 2), active HBV/HCV, uncontrolled cardiovascular disease, or prior malignancies within 5 years. Pregnancy and inadequate contraception are also exclusionary.
Click to Show/Hide
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06754930 | Clinical Status | PHASE1|||PHASE2 | ||
| Clinical Description |
A Multicenter, Open Phase IB/II Clinical Study of Safety, Tolerability, and Efficacy of SHR-1826 in Combination With Other Anti-cancer Treatment in Patients With Non-small Cell Lung Cancer
|
||||
| Primary Endpoint |
The study assesses the Recommended Phase II Dose (RP2D) alongside safety and efficacy through Adverse Events (AEs) and Objective Response Rate (ORR) over an average of 1 year from screening to study completion.
|
||||
| Other Endpoint |
Secondary outcomes include Disease Control Rate (DCR), Duration of Response (DoR), Progression-Free Survival (PFS), and Overall Survival (OS). Pharmacokinetics (blood concentrations of SHR-1826 and free toxin) and immunogenicity (anti-drug antibodies, ADA) will also be evaluated throughout the study, spanning approximately 1 year.
|
||||
| Experiment 2 Reporting the Activity Date of This ADC | [2] | ||||
| Patients Enrolled |
Eligible NSCLC patients must have ECOG 0-1, measurable lesions (RECIST v1.1), adequate organ function, and provide tumor samples. Key exclusions include active CNS metastases, interstitial pneumonitis, recent therapies/infections, unresolved toxicities (>CTCAE v5.0 Grade 1), HIV positivity, or other investigators' safety concerns.
|
||||
| Administration Dosage |
SHR-1826 Administration by intravenous infusion for a cycle of 3 weeks.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06844474 | Clinical Status | PHASE2 | ||
| Clinical Description |
A Phase II, Multicenter, Open-Label Clinical Study to Evaluate the Safety, Tolerability and Efficacy of SHR-1826 for Injection in Patients With NSCLC
|
||||
| Primary Endpoint |
The study primarily evaluates safety (incidence/severity of AEs/SAEs) and efficacy (Overall Response Rate - ORR) over approximately 2 years of treatment duration.
|
||||
| Other Endpoint |
Secondary endpoints include treatment duration effects like Duration of Response (DoR), Disease Control Rate (DCR), Progression-Free Survival (PFS) over ~2 years, with Overall Survival (OS) monitored for up to 5 years post-enrollment.
|
||||
| Experiment 3 Reporting the Activity Date of This ADC | [3] | ||||
| Patients Enrolled |
Eligible patients (18-75 years, ECOG 0-1) must have histologically confirmed advanced/metastatic solid tumors (measurable per RECIST v1.1) and adequate organ function. Key exclusions: active CNS metastases, prior ADC therapy, unresolved AEs (>CTCAE v5.0 Grade 1), uncontrolled infections/cardiovascular diseases, recent major surgery/radiotherapy, or conditions compromising study safety per investigator judgment. Contraception is mandatory.
Click to Show/Hide
|
||||
| Administration Dosage |
dose is calculated based on the subjects' baseline weight.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06094556 | Clinical Status | PHASE1 | ||
| Clinical Description |
A Multicenter, Open Phase I Clinical Study of Safety, Tolerability, Pharmacokinetics, and Efficacy of SHR-1826 for Injection in Patients With Advanced Solid Tumors
|
||||
| Primary Endpoint |
The primary objectives include assessing Dose-Limiting Toxicity (DLT) over 21 days, determining the Maximum Tolerated Dose (MTD) or Maximum-Administered Dose within ~1 year, and establishing the Recommended Phase 2 Dose (RP2D) over ~2 years to evaluate safety and efficacy during dose escalation.
|
||||
| Other Endpoint |
Pharmacokinetic (PK) analysis of SHR-1826 covers Cmax, Tmax, AUC, t1/2, MRT, CL, and Vss over ~2 years alongside immunogenicity (anti-drug antibodies). Preliminary efficacy endpoints include ORR, DoR, DCR, PFS, and OS, all measured over ~2 years.
|
||||
| Experiment 4 Reporting the Activity Date of This ADC | [4] | ||||
| Patients Enrolled |
Eligible patients (18-75 years, ECOG 0-1, advanced solid tumors, measurable lesions per RECIST v1.1) must meet organ function criteria; exclusions include CNS metastasis, prior topoisomerase I inhibitor/EGFR-c-Met therapy, unresolved toxicities >Grade 2, active infections, or uncontrolled comorbidities.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06703177 | Clinical Status | PHASE1|||PHASE2 | ||
| Clinical Description |
Phase IB/II Study of Safety, Tolerability and Efficacy of SHR-1826 for Injection in Combination With Other Antitumor Therapies in Subjects With Solid Tumors
|
||||
| Primary Endpoint |
Phase 1 primary outcomes include RP2D determination, AE assessment, and Phase 2 ORR evaluation, all monitored from screening to study completion (average 1 year).
|
||||
| Other Endpoint |
Phase 1/2 secondary measures encompass ORR, DCR, DoR, PFS, OS, ADA, SHR-1826 blood concentration, free toxin SHR169265 levels, and AE tracking, with consistent timeframes across both phases.
|
||||
References
