General Information of This Antibody (ID: ANTI0TTDLU)
Antibody Name
Antibody 12
Synonyms
Antibody 12
   Click to Show/Hide
Antibody Type
Monoclonal antibody (mAb)
Antibody Subtype
Humanized lgG1
Antigen Name
Syndecan-1 (SDC1)
 Antigen Info 
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Varible Domain
QVQLVQSGAEVKKPGSSVKVSCKASGYTESNYWIEWVRQAPGQGLEWIGEILPGTGRTIY
NEKFKGRVTFTADESTSTAYMELSSLRSEDTAVYYCARRDYYGNFYYAMDYWGQGTLVTV
SS
    Click to Show/Hide
Heavy Chain CDR 1
NYWIE
    Click to Show/Hide
Heavy Chain CDR 2
EILPGTGRTIYNEKFKG
    Click to Show/Hide
Heavy Chain CDR 3
RDYYGNFYYAMDY
    Click to Show/Hide
Light Chain Varible Domain
DIQMTQSPSSLSASVGDRVTITCSASQGINNYLNWYQQKPGKAPKLLIYYTSTLQSGVPS
RESGSGSGTDYTLTISSLQPEDFATYYCQQYSKLPRTFGGGTKVEIK
    Click to Show/Hide
Light Chain CDR 1
SASQGINNYLN
    Click to Show/Hide
Light Chain CDR 2
YTSTLQS
    Click to Show/Hide
Light Chain CDR 3
QQYSKLPRT
    Click to Show/Hide
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
WO2024181570A1 ADC14 [Investigative]
Discovered Using Cell Line-derived Xenograft Model
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth lnhibition value (TGl) ≈ 85% Positive CD138 expression (CD138+++/++)
Method Description
1x107cells/100 uL, ADC3 at 1 mg/kg, intravenous injection,
In Vivo Model Capan-1 derived Xenograft Model
Revealed Based on the Cell Line Data
Click To Hide/Show 2 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
57 ng/mL
Positive CD138 expression (CD138+++/++)
Method Description
1000 cells/well of Capan-1 in 96 well, 37 °C for 5 days.
In Vitro Model Pancreatic ductal adenocarcinoma Capan-1 cells CVCL_0237
Experiment 2 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
4761 ng/mL
Negative CD138 expression (CD138-)
Method Description
1000 cells/well of Jurkat in 96 well, 37 °C for 5 days.
In Vitro Model T acute lymphoblastic leukemia Jurkat cells CVCL_0065
References
Ref 1 Antibody-drug complexes containing anti-CD138 antibodies