Antibody Information
General Information of This Antibody (ID: ANTI0SSBHZ)
| Antibody Name | hmAb-H11a |
|||||
|---|---|---|---|---|---|---|
| Organization | DAIICHI SAMKO COMPANY, LIMITED |
|||||
| Synonyms |
hmAb-H11a
Click to Show/Hide
|
|||||
| Antibody Type | Monoclonal antibody (mAb) |
|||||
| Antibody Subtype | Humanized lgG1 |
|||||
| Antigen Name | Leukocyte antigen CD37 (CD37) |
Antigen Info | ||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Sequence |
EVQLVQSGAEVKKPGASVKVSCKASCYSFTDYNMYWVRQAPGQSLEWMGYIDPYNGDTTY
NQKFQCRVTITADKSKSTAYMELSSLRSEDTAVYYCARSPYGHYAMDYWGQGTLNTVSSA STKGPSVFPLAPSSKSTSGCTAALGCLVKDYFPEPVTVsWNSGALTSGVHTFPAVLQSSG LYSLSSVVTVPSSSLCIQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGP SVFLFPPKPKDTLMISRTPEVTCvVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEM TKNQVSLTCINKGFYPSDIAVEWESNGQPENNYKTTpPVLDSDGSPFLYSKLTVDKSRWQ QGNVFScSvMHEALHNHYTQKSLSLSPGK Click to Show/Hide
|
|||||
| Heavy Chain Varible Domain |
EVQLVQSGAEVKKPGASVKVSCKASCYSFTDYNMYWVRQAPGQSLEWMGYIDPYNGDTTY
NQKFQCRVTITADKSKSTAYMELSSLRSEDTAVYYCARSPYGHYAMDYWGQGTLNTVSS Click to Show/Hide
|
|||||
| Heavy Chain CDR 1 |
GYSFTDYNMY
Click to Show/Hide
|
|||||
| Heavy Chain CDR 2 |
YIDPYNGDTT
Click to Show/Hide
|
|||||
| Heavy Chain CDR 3 |
SPYGHYAMDY
Click to Show/Hide
|
|||||
| Light Chain Sequence |
DIQMTQSPSSLSASVGDRVTIrCKASQDVSTAVDWYQQKPGKAPKLLINWASTRHTGVPS
RFSGSGSGTDPTLTISSLQPEDFATYYCRQHYSTPFTFGQGTKVEIKRTVAAPSVFIFPP SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Click to Show/Hide
|
|||||
| Light Chain Varible Domain |
DIQMTQSPSSLSASVGDRVTIrCKASQDVSTAVDWYQQKPGKAPKLLINWASTRHTGVPS
RFSGSGSGTDPTLTISSLQPEDFATYYCRQHYSTPFTFGQGTKVEIKR Click to Show/Hide
|
|||||
| Light Chain CDR 1 |
KASQDVSTAVD
Click to Show/Hide
|
|||||
| Light Chain CDR 2 |
WASTRHT
Click to Show/Hide
|
|||||
| Light Chain CDR 3 |
ROQHYSTPFT
Click to Show/Hide
|
|||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
hmAb-H11aL11-DXd [Investigative]
Discovered Using Cell Line-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth lnhibition value (TGl) | < 30% | Positive CD37 expression (CD37+++/++) | ||
| Method Description |
CD37-positive human diffuse large B-cell lymphoma cell line SU-DHL-8 (ATCC) was subcutaneously inoculated at a dose of 5x106 cells to the right flank region of each five or six-week-old female SCID mouse (Day 0). On Day 7, the mice were randomly grouped. On the day of grouping, the antibodydrug conjugates hmAb-H11L11-DXd was intravenously administered at a dose of 1 mg/kg to the tail of each mouse. An antibody-drug conjugate (hmAb-IgG1-DXd) produced using human IgG was administered as a negative control at a dose of 3 mg/kg in the same manner as above. The long diameter and short diameter of the inoculated tumor were measured twice a week using electronic digital calipers, and the volume of the tumor was then calculated.
Click to Show/Hide
|
||||
| In Vivo Model | SU-DHL-8 (ATCC) female SCID mouse model | ||||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth lnhibition value (TGl) | > 50% | Positive CD37 expression (CD37+++/++) | ||
| Method Description |
CD37-positive human diffuse large B-cell lymphoma cell line OCI-LY7 (DSMZ) was subcutaneously inoculated at a dose of 1x107 cells to the right flank region of each five or six-week-old female SCID mouse (Day 0). On Day 9, the mice were randomly grouped. On the day of grouping, the antibodydrug conjugates hmAb-H11L11-DXd was intravenously administered at a dose of 1 mg/kg to the tail of each mouse. An antibody-drug conjugate (hmAb-IgG1-DXd) produced using human IgG was administered as a negative control at a dose of 3 mg/kg in the same manner as above. The long diameter and short diameter of the inoculated tumor were measured twice a week using electronic digital calipers, and the volume of the tumor was then calculated.
Click to Show/Hide
|
||||
| In Vivo Model | OCI-LY7 (DSMZ) female SCID mouse model | ||||
| Experiment 3 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth lnhibition value (TGl) | > 50% | Positive CD37 expression (CD37+++/++) | ||
| Method Description |
CD37-positive human diffuse large B-cell lymphoma cell line WSU-DLCL2 (DSMZ) was subcutaneously inoculated at a dose of 1x107 cells to the right flank region of each five or six-week-old female SCID mouse (Day 0). On Day 11, the mice were randomly grouped. On the day of grouping, the antibodydrug conjugates hmAb-H11L11-DXd was intravenously administered at a dose of 1 mg/kg to the tail of each mouse. An antibody-drug conjugate (hmAb-IgG1-DXd) produced using human IgG was administered as a negative control at a dose of 3 mg/kg in the same manner as above. The long diameter and short diameter of the inoculated tumor were measured twice a week using electronic digital calipers, and the volume of the tumor was then calculated.
Click to Show/Hide
|
||||
| In Vivo Model | WSU-DLCL2 (DSMZ) female SCID mouse model | ||||
| Experiment 4 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth lnhibition value (TGl) | > 90% | Positive CD37 expression (CD37+++/++) | ||
| Method Description |
CD37-positive human diffuse large B-cell lymphoma cell line WSU-DLCL2 (DSMZ) was subcutaneously inoculated at a dose of 1x107 cells to the right flank region of each five or six-week-old female SCID mouse (Day 0). On Day 11, the mice were randomly grouped. On the day of grouping, the antibodydrug conjugates hmAb-H11L11-DXd was intravenously administered at a dose of 1 mg/kg to the tail of each mouse. An antibody-drug conjugate (hmAb-IgG1-DXd) produced using human IgG was administered as a negative control at a dose of 3 mg/kg in the same manner as above. The long diameter and short diameter of the inoculated tumor were measured twice a week using electronic digital calipers, and the volume of the tumor was then calculated.
Click to Show/Hide
|
||||
| In Vivo Model | WSU-DLCL2 (DSMZ) female SCID mouse model | ||||
| Experiment 5 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth lnhibition value (TGl) | > 100% | Positive CD37 expression (CD37+++/++) | ||
| Method Description |
CD37-positive human diffuse large B-cell lymphoma cell line OCI-LY7 (DSMZ) was subcutaneously inoculated at a dose of 1x107 cells to the right flank region of each five or six-week-old female SCID mouse (Day 0). On Day 9, the mice were randomly grouped. On the day of grouping, the antibodydrug conjugates hmAb-H11L11-DXd was intravenously administered at a dose of 1 mg/kg to the tail of each mouse. An antibody-drug conjugate (hmAb-IgG1-DXd) produced using human IgG was administered as a negative control at a dose of 3 mg/kg in the same manner as above. The long diameter and short diameter of the inoculated tumor were measured twice a week using electronic digital calipers, and the volume of the tumor was then calculated.
Click to Show/Hide
|
||||
| In Vivo Model | OCI-LY7 (DSMZ) female SCID mouse model | ||||
| Experiment 6 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth lnhibition value (TGl) | > 100% | Positive CD37 expression (CD37+++/++) | ||
| Method Description |
CD37-positive human diffuse large B-cell lymphoma cell line SU-DHL-8 (ATCC) was subcutaneously inoculated at a dose of 5x106 cells to the right flank region of each five or six-week-old female SCID mouse (Day 0). On Day 7, the mice were randomly grouped. On the day of grouping, the antibodydrug conjugates hmAb-H11L11-DXd was intravenously administered at a dose of 1 mg/kg to the tail of each mouse. An antibody-drug conjugate (hmAb-IgG1-DXd) produced using human IgG was administered as a negative control at a dose of 3 mg/kg in the same manner as above. The long diameter and short diameter of the inoculated tumor were measured twice a week using electronic digital calipers, and the volume of the tumor was then calculated.
Click to Show/Hide
|
||||
| In Vivo Model | SU-DHL-8 (ATCC) female SCID mouse model | ||||
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) | ≈ 2 nM | Positive CD37 expression (CD37+++/++) | ||
| Method Description |
human diffuse large B-cell lymphoma cell line OCI-LY7 (DSMZ) , 5x10-cells/100 ML/well , IMDM medium, hmAbH11laL11-DXd was added to the cells such that the final concentrations were from 0.0064 nM to 20 nM. The cells were cultured under conditions of 37°C. and 5% CO2 for 6 days, and thereafter, the number of live cells was measured.
|
||||
| In Vitro Model | Diffuse large B-cell lymphoma germinal center B-cell type, Diffuse large B-cell lymphoma | OCI-LY7 cells | CVCL_1881 | ||
