Antibody Information
General Information of This Antibody
| Antibody ID | ANTI0SKRVW |
|||||
|---|---|---|---|---|---|---|
| Antibody Name | Anti-HER2 Fab |
|||||
| Organization | School of Pharmaceutical Sciences, Wuhan University. |
|||||
| Synonyms |
Anti-HER2 Fab
Click to Show/Hide
|
|||||
| Antibody Type | Fragment of Antigen Binding (Fab) |
|||||
| Antigen Name | Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
Antigen Info | ||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Sequence |
MDIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYSASFLYSGVP
SRFSGSRSGTDFTLTISSLQPEDFATYYCQQHYTTPPTFGQGTKVEIKRTVAAPSVFIFP PSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGECASENLYFQSGSGGSGRGSGSHHHEG DGHHHGESEGHHHGSRGHHHSGSGSDGGSGSENLYFQSEVQLVESGGGLVQPGGSLRLSC AASGFNIKDTYIHWVRQAPGKGLEWVARIYPTNGYTRYADSVKGRFTISADTSKNTAYLQ MNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGT AALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYI CNVNHKPSNTKVDKRVEPKSCDKLPETGG Click to Show/Hide
|
|||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
Fab-SN38 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
2.23۪.14 nM
|
High HER2 expression (HER2 +++) | ||
| Method Description |
The cytotoxicity of Fab-SN38 was evaluated using the Cell Counting Kit-8 (CCK-8) assay. Cells (MDA-MB-231, Calu-3, NCI-N87 and SK-OV-3 cells) were seeded into clear-bottom 96-well plates (~3000 cells per well). After overnight culture, the medium was removed and the fresh medium containing SN38, Glu (SN38)-OH, Glu-SN38, trastuzumab, the Fab protein or the Fab-SN38 conjugate was added and incubated for 72 h at 37 °C in a CO2 incubator. Cell viability was measured using the CCK-8 reagent according to the protocol. Briefly, 15 uL of CCK-8 solution was added to the culture media. Two hours after incubation at 37 °C, the absorbance at a wavelength of 450 nm was measured by a microplate reader (TECAN, Switzerland) and then the IC50 value was profiled using the Graphpad Prism 8 software.
Click to Show/Hide
|
||||
| In Vitro Model | Ovarian serous cystadenocarcinoma | SK-OV-3 cells | CVCL_0532 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
3.5۪.16 nM
|
High HER2 expression (HER2 +++) | ||
| Method Description |
The cytotoxicity of Fab-SN38 was evaluated using the Cell Counting Kit-8 (CCK-8) assay. Cells (MDA-MB-231, Calu-3, NCI-N87 and SK-OV-3 cells) were seeded into clear-bottom 96-well plates (~3000 cells per well). After overnight culture, the medium was removed and the fresh medium containing SN38, Glu (SN38)-OH, Glu-SN38, trastuzumab, the Fab protein or the Fab-SN38 conjugate was added and incubated for 72 h at 37 °C in a CO2 incubator. Cell viability was measured using the CCK-8 reagent according to the protocol. Briefly, 15 uL of CCK-8 solution was added to the culture media. Two hours after incubation at 37 °C, the absorbance at a wavelength of 450 nm was measured by a microplate reader (TECAN, Switzerland) and then the IC50 value was profiled using the Graphpad Prism 8 software.
Click to Show/Hide
|
||||
| In Vitro Model | Lung adenocarcinoma | Calu-3 cells | CVCL_0609 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
8.47۪.29 nM
|
Positive HER2 expression (HER2+++/++) | ||
| Method Description |
The cytotoxicity of Fab-SN38 was evaluated using the Cell Counting Kit-8 (CCK-8) assay. Cells (MDA-MB-231, Calu-3, NCI-N87 and SK-OV-3 cells) were seeded into clear-bottom 96-well plates (~3000 cells per well). After overnight culture, the medium was removed and the fresh medium containing SN38, Glu (SN38)-OH, Glu-SN38, trastuzumab, the Fab protein or the Fab-SN38 conjugate was added and incubated for 72 h at 37 °C in a CO2 incubator. Cell viability was measured using the CCK-8 reagent according to the protocol. Briefly, 15 uL of CCK-8 solution was added to the culture media. Two hours after incubation at 37 °C, the absorbance at a wavelength of 450 nm was measured by a microplate reader (TECAN, Switzerland) and then the IC50 value was profiled using the Graphpad Prism 8 software.
Click to Show/Hide
|
||||
| In Vitro Model | Gastric tubular adenocarcinoma | NCI-N87 cells | CVCL_1603 | ||
| Experiment 4 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) | > 1000 nM | Negative HER2 expression (HER2-) | ||
| Method Description |
The cytotoxicity of Fab-SN38 was evaluated using the Cell Counting Kit-8 (CCK-8) assay. Cells (MDA-MB-231, Calu-3, NCI-N87 and SK-OV-3 cells) were seeded into clear-bottom 96-well plates (~3000 cells per well). After overnight culture, the medium was removed and the fresh medium containing SN38, Glu (SN38)-OH, Glu-SN38, trastuzumab, the Fab protein or the Fab-SN38 conjugate was added and incubated for 72 h at 37 °C in a CO2 incubator. Cell viability was measured using the CCK-8 reagent according to the protocol. Briefly, 15 uL of CCK-8 solution was added to the culture media. Two hours after incubation at 37 °C, the absorbance at a wavelength of 450 nm was measured by a microplate reader (TECAN, Switzerland) and then the IC50 value was profiled using the Graphpad Prism 8 software.
Click to Show/Hide
|
||||
| In Vitro Model | Breast adenocarcinoma | MDA-MB-231 cells | CVCL_0062 | ||