General Information of This Antibody (ID: ANTI0SHIKK)
Antibody Name
becotatug
Antigen Name
EGFR
 Antigen Info 
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence
QVQLQESGPGLVKPSETLSLTCTVSGFSLSNYDVHWVRQAPGKGLEWLGVIWSGGNTDYN
TPFTSRLTISVDTSKNQFSLKLSSVTAADTAVYYCARALDYYDYEFAYWGQGTLVTVSSA
STKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG
LYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGP
SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS
TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEM
TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ
QGNVFSCSVMHEALHNHYTQKSLSLSPGK
    Click to Show/Hide
Heavy Chain Varible Domain
QVQLQESGPGLVKPSETLSLTCTVSGFSLSNYDVHWVRQAPGKGLEWLGVIWSGGNTDYN
TPFTSRLTISVDTSKNQFSLKLSSVTAADTAVYYCARALDYYDYEFAYWGQGTLVTVSSA
STKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG
LYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGP
SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS
TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEM
TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ
QGNVFSCSVMHEALHNHYTQKSLSLSPGK
    Click to Show/Hide
Light Chain Sequence
EIVLTQSPDFQSVTPKEKVTITCRASQSIGTNIHWYQQKPDQSPKLLIKYASESISGIPS
RFSGSGSGTDFTLTINSLEAEDAATYYCQQNNEWPTSFGQGTKLEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
    Click to Show/Hide
Light Chain Varible Domain
EIVLTQSPDFQSVTPKEKVTITCRASQSIGTNIHWYQQKPDQSPKLLIKYASESISGIPS
RFSGSGSGTDFTLTINSLEAEDAATYYCQQNNEWPTSFGQGTKLEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
    Click to Show/Hide
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
Becotatug vedotin [Approved in 2025]
Identified from the Human Clinical Data
Click To Hide/Show 18 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Progression Free Survival
4.2 months
Patients Enrolled
Eligible patients (≥18 years) have platinum/anti-PD-1-refractory recurrent/metastatic head and neck squamous cell carcinoma with measurable lesions (RECIST v1.1), ECOG 0-1, and adequate organ function (LVEF≥50%). Excluded are those with ≥4 prior systemic therapies, active CNS metastasis, uncontrolled cardiovascular/bleeding disorders, HBV/HCV/HIV, interstitial lung disease, or recent live vaccines (30 days). Prior anti-tumor therapies within specified washout periods (chemotherapy 3 weeks, targeted therapy 2 weeks, immunotherapy 4 weeks) are prohibited. Strict contraception and negative pregnancy tests are required. The study prioritizes patient safety with rigorous exclusion criteria for comorbidities.

   Click to Show/Hide
Administration Dosage
On the first day of every 3 weeks, MRG003 will be administered via intravenous infusion at 2.0 mg/kg calculated based on the actual body weight
Related Clinical Trial
NCT Number NCT04868162  Clinical Status PHASE2
Clinical Description
An Open-Label, Single Arm, Multi-Center Phase II Clinical Study to Evaluate the Efficacy and Safety of MRG003 in Patients With Recurrent or Metastatic Squamous Cell Carcinoma of Head and Neck.
Primary Endpoint
The primary endpoint is IRC-assessed ORR (complete/partial responses per RECIST v1.1) evaluated over 24 months, with safety monitoring through AEs (45 days post-treatment) regardless of causality.
Other Endpoint
Secondary endpoints include investigator-assessed ORR, PFS/PFSR, DoR, DCR, and OS (24 months), alongside PK parameters (Cmax/AUClast for MRG003, total antibody, and MMAE over 30 days) and ADA immunogenicity incidence. Comprehensive efficacy and pharmacokinetic profiles are evaluated.
Experiment 2 Reporting the Activity Date of This ADC [2]
Efficacy Data Progression Free Survival
7.3 months
Patients Enrolled
Eligible patients (18-75 years) have platinum/PD- (L)1-refractory metastatic nasopharyngeal carcinoma (Part A: ≥1 prior line; Part B: ≥2 prior lines including platinum, gemcitabine/taxanes) with measurable lesions (RECIST v1.1), ECOG 0-1, and adequate organ function (LVEF≥50%). Exclusions: grade≥2 neuropathy, active CNS metastases, recent anti-tumor therapy (chemotherapy/targeted therapy within 3 weeks; immunotherapy/radiotherapy within 4 weeks), uncontrolled comorbidities (cardiac, hypertension, diabetes, HBV/HCV/HIV), ILD, or strong CYP3A4 modulators. Strict contraception and negative pregnancy tests (72 hours) are required.

   Click to Show/Hide
Administration Dosage
Part A: On the first day of every 3 weeks, MRG003 will be administered via intravenous infusion at 2.0 mg/kg or 2.3 mg/kg calculated based on the actual body weight.Part B: On the first day of every 3 weeks, MRG003 will be administered via intravenous infusion at 2.3 mg/kg calculated based on the actual body weight.
Related Clinical Trial
NCT Number NCT05126719  Clinical Status PHASE2
Clinical Description
An Open-Label, Multi-Center Phase II Clinical Study to Evaluate the Efficacy and Safety of MRG003 in Patients With Recurrent Metastatic Nasopharyngeal Carcinoma
Primary Endpoint
The primary endpoint is IRC-assessed ORR (complete/partial responses per RECIST v1.1), evaluated from baseline until disease progression, intolerable toxicity, withdrawal, or study discontinuation (up to 24 months), with comprehensive efficacy assessment.
Other Endpoint
Secondary endpoints include investigator-assessed ORR, PFS (time to progression/death), DoR (response duration), DCR (CR/PR/SD rates), and OS (time to death), along with PK parameters (Cmax/AUClast for MRG003, total antibody, and MMAE over 30 days) and ADA immunogenicity incidence, all tracked until progression/discontinuation (24 months). Safety monitoring covers AEs (30 days post-treatment) and SAEs (45 days).

   Click to Show/Hide
Experiment 3 Reporting the Activity Date of This ADC [3]
Efficacy Data Partial Response (PR)
5
21 %
Patients Enrolled
Eligible patients (18-75 years, ECOG 0-1) include Phase Ia (advanced solid tumors) and Phase Ib (EGFR+ colorectal, HNSCC, or nasopharyngeal cancer) with measurable lesions (RECIST v1.1) and adequate organ function. Exclusions: CNS metastasis, prior malignancies (exceptions apply), uncontrolled systemic/hepatic/cardiac diseases, active HIV, recent anti-tumor therapies/surgeries, high-risk ophthalmic/skin conditions, or pregnancy/breastfeeding. Contraception is mandatory for participants of childbearing potential.

   Click to Show/Hide
Administration Dosage
Phase Ia: MRG003 will be administrated by an IV infusion of escalating doses (0.1, 0.3, 0.6, 1.0, 2.0, 2.5, 3.0 mg/kg) on Day 1 of every 3 weeks (Q3W); Phase Ib: MRG003 will be administrated by an IV infusion of MTD/RP2D.
Related Clinical Trial
NCT Number NCT04868344  Clinical Status PHASE1
Clinical Description
An Open-Label, Dose-Finding, Phase I Study in Solid Tumors.
Primary Endpoint
Phase Ia assesses Dose-Limiting Toxicity (DLT) during the first 21-day cycle, while Phase Ib evaluates Objective Response Rate (ORR) per RECIST v1.1 (CR+PR) over 24 weeks.
Other Endpoint
Pharmacokinetic parameters (Cmax, AUClast) for MRG003, total antibody, and MMAE are analyzed through blood samples with descriptive statistics. Immunogenicity is monitored via anti-drug antibody (ADA) assessments. Phase Ib additionally tracks PFS, DoR, and OS over 24 weeks. Safety includes AE/SAE incidence per NCI-CTCAE v5.0 until 30 days post-treatment.

   Click to Show/Hide
Experiment 4 Reporting the Activity Date of This ADC [3]
Efficacy Data Partial Response (PR)
23
31 %
Patients Enrolled
Eligible patients (18-75 years, ECOG 0-1) include Phase Ia (advanced solid tumors) and Phase Ib (EGFR+ colorectal, HNSCC, or nasopharyngeal cancer) with measurable lesions (RECIST v1.1) and adequate organ function. Exclusions: CNS metastasis, prior malignancies (exceptions apply), uncontrolled systemic/hepatic/cardiac diseases, active HIV, recent anti-tumor therapies/surgeries, high-risk ophthalmic/skin conditions, or pregnancy/breastfeeding. Contraception is mandatory for participants of childbearing potential.

   Click to Show/Hide
Administration Dosage
Phase Ia: MRG003 will be administrated by an IV infusion of escalating doses (0.1, 0.3, 0.6, 1.0, 2.0, 2.5, 3.0 mg/kg) on Day 1 of every 3 weeks (Q3W); Phase Ib: MRG003 will be administrated by an IV infusion of MTD/RP2D.
Related Clinical Trial
NCT Number NCT04868344  Clinical Status PHASE1
Clinical Description
An Open-Label, Dose-Finding, Phase I Study in Solid Tumors.
Primary Endpoint
Phase Ia assesses Dose-Limiting Toxicity (DLT) during the first 21-day cycle, while Phase Ib evaluates Objective Response Rate (ORR) per RECIST v1.1 (CR+PR) over 24 weeks.
Other Endpoint
Pharmacokinetic parameters (Cmax, AUClast) for MRG003, total antibody, and MMAE are analyzed through blood samples with descriptive statistics. Immunogenicity is monitored via anti-drug antibody (ADA) assessments. Phase Ib additionally tracks PFS, DoR, and OS over 24 weeks. Safety includes AE/SAE incidence per NCI-CTCAE v5.0 until 30 days post-treatment.

   Click to Show/Hide
Experiment 5 Reporting the Activity Date of This ADC [1]
Efficacy Data Objective Response Rate (ORR)
30.60%
Patients Enrolled
Eligible patients (≥18 years) have platinum/anti-PD-1-refractory recurrent/metastatic head and neck squamous cell carcinoma with measurable lesions (RECIST v1.1), ECOG 0-1, and adequate organ function (LVEF≥50%). Excluded are those with ≥4 prior systemic therapies, active CNS metastasis, uncontrolled cardiovascular/bleeding disorders, HBV/HCV/HIV, interstitial lung disease, or recent live vaccines (30 days). Prior anti-tumor therapies within specified washout periods (chemotherapy 3 weeks, targeted therapy 2 weeks, immunotherapy 4 weeks) are prohibited. Strict contraception and negative pregnancy tests are required. The study prioritizes patient safety with rigorous exclusion criteria for comorbidities.

   Click to Show/Hide
Administration Dosage
On the first day of every 3 weeks, MRG003 will be administered via intravenous infusion at 2.0 mg/kg calculated based on the actual body weight
Related Clinical Trial
NCT Number NCT04868162  Clinical Status PHASE2
Clinical Description
An Open-Label, Single Arm, Multi-Center Phase II Clinical Study to Evaluate the Efficacy and Safety of MRG003 in Patients With Recurrent or Metastatic Squamous Cell Carcinoma of Head and Neck.
Primary Endpoint
The primary endpoint is IRC-assessed ORR (complete/partial responses per RECIST v1.1) evaluated over 24 months, with safety monitoring through AEs (45 days post-treatment) regardless of causality.
Other Endpoint
Secondary endpoints include investigator-assessed ORR, PFS/PFSR, DoR, DCR, and OS (24 months), alongside PK parameters (Cmax/AUClast for MRG003, total antibody, and MMAE over 30 days) and ADA immunogenicity incidence. Comprehensive efficacy and pharmacokinetic profiles are evaluated.
Experiment 6 Reporting the Activity Date of This ADC [2]
Efficacy Data Objective Response Rate (ORR)
39.3. 55.2 %
Patients Enrolled
Eligible patients (18-75 years) have platinum/PD- (L)1-refractory metastatic nasopharyngeal carcinoma (Part A: ≥1 prior line; Part B: ≥2 prior lines including platinum, gemcitabine/taxanes) with measurable lesions (RECIST v1.1), ECOG 0-1, and adequate organ function (LVEF≥50%). Exclusions: grade≥2 neuropathy, active CNS metastases, recent anti-tumor therapy (chemotherapy/targeted therapy within 3 weeks; immunotherapy/radiotherapy within 4 weeks), uncontrolled comorbidities (cardiac, hypertension, diabetes, HBV/HCV/HIV), ILD, or strong CYP3A4 modulators. Strict contraception and negative pregnancy tests (72 hours) are required.

   Click to Show/Hide
Administration Dosage
Part A: On the first day of every 3 weeks, MRG003 will be administered via intravenous infusion at 2.0 mg/kg or 2.3 mg/kg calculated based on the actual body weight.Part B: On the first day of every 3 weeks, MRG003 will be administered via intravenous infusion at 2.3 mg/kg calculated based on the actual body weight.
Related Clinical Trial
NCT Number NCT05126719  Clinical Status PHASE2
Clinical Description
An Open-Label, Multi-Center Phase II Clinical Study to Evaluate the Efficacy and Safety of MRG003 in Patients With Recurrent Metastatic Nasopharyngeal Carcinoma
Primary Endpoint
The primary endpoint is IRC-assessed ORR (complete/partial responses per RECIST v1.1), evaluated from baseline until disease progression, intolerable toxicity, withdrawal, or study discontinuation (up to 24 months), with comprehensive efficacy assessment.
Other Endpoint
Secondary endpoints include investigator-assessed ORR, PFS (time to progression/death), DoR (response duration), DCR (CR/PR/SD rates), and OS (time to death), along with PK parameters (Cmax/AUClast for MRG003, total antibody, and MMAE over 30 days) and ADA immunogenicity incidence, all tracked until progression/discontinuation (24 months). Safety monitoring covers AEs (30 days post-treatment) and SAEs (45 days).

   Click to Show/Hide
Experiment 7 Reporting the Activity Date of This ADC [3]
Efficacy Data Objective Response Rate (ORR)
40
44
0 %
Patients Enrolled
Eligible patients (18-75 years, ECOG 0-1) include Phase Ia (advanced solid tumors) and Phase Ib (EGFR+ colorectal, HNSCC, or nasopharyngeal cancer) with measurable lesions (RECIST v1.1) and adequate organ function. Exclusions: CNS metastasis, prior malignancies (exceptions apply), uncontrolled systemic/hepatic/cardiac diseases, active HIV, recent anti-tumor therapies/surgeries, high-risk ophthalmic/skin conditions, or pregnancy/breastfeeding. Contraception is mandatory for participants of childbearing potential.

   Click to Show/Hide
Administration Dosage
Phase Ia: MRG003 will be administrated by an IV infusion of escalating doses (0.1, 0.3, 0.6, 1.0, 2.0, 2.5, 3.0 mg/kg) on Day 1 of every 3 weeks (Q3W); Phase Ib: MRG003 will be administrated by an IV infusion of MTD/RP2D.
Related Clinical Trial
NCT Number NCT04868344  Clinical Status PHASE1
Clinical Description
An Open-Label, Dose-Finding, Phase I Study in Solid Tumors.
Primary Endpoint
Phase Ia assesses Dose-Limiting Toxicity (DLT) during the first 21-day cycle, while Phase Ib evaluates Objective Response Rate (ORR) per RECIST v1.1 (CR+PR) over 24 weeks.
Other Endpoint
Pharmacokinetic parameters (Cmax, AUClast) for MRG003, total antibody, and MMAE are analyzed through blood samples with descriptive statistics. Immunogenicity is monitored via anti-drug antibody (ADA) assessments. Phase Ib additionally tracks PFS, DoR, and OS over 24 weeks. Safety includes AE/SAE incidence per NCI-CTCAE v5.0 until 30 days post-treatment.

   Click to Show/Hide
Experiment 8 Reporting the Activity Date of This ADC [4]
Efficacy Data Objective Response Rate (ORR)
63%
Patients Enrolled
Eligible patients (18-75 years, BMI≥17, ECOG 0-1) must have EGFR+ advanced solid tumors (NSCLC, SCCHN, NPC) with measurable lesions (RECIST v1.1), adequate organ function, and life expectancy ≥12 weeks. Exclusions: CNS metastasis, prior MMAE/MMAF ADC treatment, Grade ≥2 neuropathy, uncontrolled systemic/liver/cardiac diseases, active infections (HBV/HCV/HIV), interstitial lung disease, recent major surgery/transplants, pregnancy/breastfeeding, or investigator-assessed ineligibility. Contraception is mandatory for participants of childbearing potential.

   Click to Show/Hide
Administration Dosage
Experimental: MRG003+HX008, MRG003 will be administrated via intravenous infusion at 1.5, 2.0 mg/kg (MTD=2.5 mg/kg) once on Day 1 of every 3 weeks (21-day cycle). HX008 will be administrated via intravenous infusion at 3 mg/kg once on Day 1 of every 3 weeks (21-day cycle).
Related Clinical Trial
NCT Number NCT05688605  Clinical Status PHASE1|||PHASE2
Clinical Description
An Open-label, Multi-center, Phase I/II Dose Escalation and Expansion Study to Evaluate the Safety, Tolerability, Pharmacokinetics and Efficacy of MRG003 in Combination With HX008 in Patients With EGFR-positive Advanced Solid Tumors
Primary Endpoint
The study identifies Maximum Tolerated Dose (MTD) within 21 days of the last patient's first dose in the MTD group, defined as the highest dose with <33% DLT occurrence. The Recommended Phase II Dose (RP2D) is determined based on safety, efficacy, and PK data over 12 months. Objective Response Rate (ORR) is evaluated per RECIST v1.1, measuring the proportion of patients achieving complete response (CR) or partial response (PR).

   Click to Show/Hide
Other Endpoint
Secondary outcomes include Duration of Response (DOR), Disease Control Rate (DCR), Progression-Free Survival (PFS), and Overall Survival (OS), all tracked over 12 months. Immunogenicity is assessed via anti-drug antibody (ADA) incidence up to 90 days post-treatment. Safety monitoring covers Adverse Events (AEs) until 30 days and Serious Adverse Events (SAEs) until 90 days post-treatment. PK analysis includes drug concentration-time profiles.

   Click to Show/Hide
Experiment 9 Reporting the Activity Date of This ADC [2]
Efficacy Data Disease control rate (DCR)
71.4
86.2 %
Patients Enrolled
Eligible patients (18-75 years) have platinum/PD- (L)1-refractory metastatic nasopharyngeal carcinoma (Part A: &ge;1 prior line; Part B: &ge;2 prior lines including platinum, gemcitabine/taxanes) with measurable lesions (RECIST v1.1), ECOG 0-1, and adequate organ function (LVEF&ge;50%). Exclusions: grade&ge;2 neuropathy, active CNS metastases, recent anti-tumor therapy (chemotherapy/targeted therapy within 3 weeks; immunotherapy/radiotherapy within 4 weeks), uncontrolled comorbidities (cardiac, hypertension, diabetes, HBV/HCV/HIV), ILD, or strong CYP3A4 modulators. Strict contraception and negative pregnancy tests (72 hours) are required.

   Click to Show/Hide
Administration Dosage
Part A: On the first day of every 3 weeks, MRG003 will be administered via intravenous infusion at 2.0 mg/kg or 2.3 mg/kg calculated based on the actual body weight.Part B: On the first day of every 3 weeks, MRG003 will be administered via intravenous infusion at 2.3 mg/kg calculated based on the actual body weight.
Related Clinical Trial
NCT Number NCT05126719  Clinical Status PHASE2
Clinical Description
An Open-Label, Multi-Center Phase II Clinical Study to Evaluate the Efficacy and Safety of MRG003 in Patients With Recurrent Metastatic Nasopharyngeal Carcinoma
Primary Endpoint
The primary endpoint is IRC-assessed ORR (complete/partial responses per RECIST v1.1), evaluated from baseline until disease progression, intolerable toxicity, withdrawal, or study discontinuation (up to 24 months), with comprehensive efficacy assessment.
Other Endpoint
Secondary endpoints include investigator-assessed ORR, PFS (time to progression/death), DoR (response duration), DCR (CR/PR/SD rates), and OS (time to death), along with PK parameters (Cmax/AUClast for MRG003, total antibody, and MMAE over 30 days) and ADA immunogenicity incidence, all tracked until progression/discontinuation (24 months). Safety monitoring covers AEs (30 days post-treatment) and SAEs (45 days).

   Click to Show/Hide
Experiment 10 Reporting the Activity Date of This ADC [4]
Efficacy Data Disease control rate (DCR)
88.90%
Patients Enrolled
Eligible patients (18-75 years, BMI&ge;17, ECOG 0-1) must have EGFR+ advanced solid tumors (NSCLC, SCCHN, NPC) with measurable lesions (RECIST v1.1), adequate organ function, and life expectancy &ge;12 weeks. Exclusions: CNS metastasis, prior MMAE/MMAF ADC treatment, Grade &ge;2 neuropathy, uncontrolled systemic/liver/cardiac diseases, active infections (HBV/HCV/HIV), interstitial lung disease, recent major surgery/transplants, pregnancy/breastfeeding, or investigator-assessed ineligibility. Contraception is mandatory for participants of childbearing potential.

   Click to Show/Hide
Administration Dosage
Experimental: MRG003+HX008, MRG003 will be administrated via intravenous infusion at 1.5, 2.0 mg/kg (MTD=2.5 mg/kg) once on Day 1 of every 3 weeks (21-day cycle). HX008 will be administrated via intravenous infusion at 3 mg/kg once on Day 1 of every 3 weeks (21-day cycle).
Related Clinical Trial
NCT Number NCT05688605  Clinical Status PHASE1|||PHASE2
Clinical Description
An Open-label, Multi-center, Phase I/II Dose Escalation and Expansion Study to Evaluate the Safety, Tolerability, Pharmacokinetics and Efficacy of MRG003 in Combination With HX008 in Patients With EGFR-positive Advanced Solid Tumors
Primary Endpoint
The study identifies Maximum Tolerated Dose (MTD) within 21 days of the last patient's first dose in the MTD group, defined as the highest dose with <33% DLT occurrence. The Recommended Phase II Dose (RP2D) is determined based on safety, efficacy, and PK data over 12 months. Objective Response Rate (ORR) is evaluated per RECIST v1.1, measuring the proportion of patients achieving complete response (CR) or partial response (PR).

   Click to Show/Hide
Other Endpoint
Secondary outcomes include Duration of Response (DOR), Disease Control Rate (DCR), Progression-Free Survival (PFS), and Overall Survival (OS), all tracked over 12 months. Immunogenicity is assessed via anti-drug antibody (ADA) incidence up to 90 days post-treatment. Safety monitoring covers Adverse Events (AEs) until 30 days and Serious Adverse Events (SAEs) until 90 days post-treatment. PK analysis includes drug concentration-time profiles.

   Click to Show/Hide
Experiment 11 Reporting the Activity Date of This ADC [3]
Efficacy Data Disease control rate (DCR)
100
89
25 %
Patients Enrolled
Eligible patients (18-75 years, ECOG 0-1) include Phase Ia (advanced solid tumors) and Phase Ib (EGFR+ colorectal, HNSCC, or nasopharyngeal cancer) with measurable lesions (RECIST v1.1) and adequate organ function. Exclusions: CNS metastasis, prior malignancies (exceptions apply), uncontrolled systemic/hepatic/cardiac diseases, active HIV, recent anti-tumor therapies/surgeries, high-risk ophthalmic/skin conditions, or pregnancy/breastfeeding. Contraception is mandatory for participants of childbearing potential.

   Click to Show/Hide
Administration Dosage
Phase Ia: MRG003 will be administrated by an IV infusion of escalating doses (0.1, 0.3, 0.6, 1.0, 2.0, 2.5, 3.0 mg/kg) on Day 1 of every 3 weeks (Q3W); Phase Ib: MRG003 will be administrated by an IV infusion of MTD/RP2D.
Related Clinical Trial
NCT Number NCT04868344  Clinical Status PHASE1
Clinical Description
An Open-Label, Dose-Finding, Phase I Study in Solid Tumors.
Primary Endpoint
Phase Ia assesses Dose-Limiting Toxicity (DLT) during the first 21-day cycle, while Phase Ib evaluates Objective Response Rate (ORR) per RECIST v1.1 (CR+PR) over 24 weeks.
Other Endpoint
Pharmacokinetic parameters (Cmax, AUClast) for MRG003, total antibody, and MMAE are analyzed through blood samples with descriptive statistics. Immunogenicity is monitored via anti-drug antibody (ADA) assessments. Phase Ib additionally tracks PFS, DoR, and OS over 24 weeks. Safety includes AE/SAE incidence per NCI-CTCAE v5.0 until 30 days post-treatment.

   Click to Show/Hide
Experiment 12 Reporting the Activity Date of This ADC [5]
Patients Enrolled
Eligible patients (18-75 years) had EGFR-positive, unresectable/metastatic biliary tract cancer refractory to &ge;1 prior therapy, with measurable lesions (RECIST v1.1), ECOG 0-1, and adequate organ function. Key exclusions included biliary obstruction, uncontrolled effusions/CNS metastasis, active infections, severe ocular/skin/pulmonary diseases, autoimmune disorders requiring immunosuppression, or prior anti-tumor therapy within 4 weeks. Treatment-related toxicities (except alopecia/asymptomatic labs) had to resolve to &le;Grade 1 (CTCAE v5.0). Pregnancy and decompensated cirrhosis (Child-Pugh B/C) were exclusionary.

   Click to Show/Hide
Administration Dosage
MRG003 will be administrated via IV infusion at 2.0 mg/kg on Day 1 of every 3 weeks (21-day cycle).
Related Clinical Trial
NCT Number NCT04838964  Clinical Status PHASE2
Clinical Description
An Open-label, Single-arm, Multi-center, Phase II Clinical Study of MRG003 in the Treatment of Patients With EGFR-positive Unresectable, Locally Advanced or Metastatic Biliary Tract Cancer
Primary Endpoint
The primary endpoint was IRC-assessed Objective Response Rate (ORR) per RECIST v1.1, evaluating complete and partial responses over 12 months from baseline.
Other Endpoint
Secondary efficacy endpoints included investigator-assessed ORR, Duration of Response (DoR), Time to Response (TTR), Disease Control Rate (DCR), Progression-Free Survival (PFS), and Overall Survival (OS). Safety assessments covered adverse events (30 days post-treatment), pharmacokinetic analysis of MRG003 (concentration-time curves), and incidence of anti-drug antibodies (ADA) in treated patients.

   Click to Show/Hide
Experiment 13 Reporting the Activity Date of This ADC [6]
Patients Enrolled
Eligible patients (18-75 years) have EGFR+/HER2- locally advanced/metastatic gastric adenocarcinoma with measurable lesions (RECIST v1.1), ECOG 0-1, adequate organ function (LVEF&ge;50%), and negative pregnancy tests. Exclusions: prior EGFR-targeted therapy hypersensitivity (4 weeks), active CNS metastasis, uncontrolled effusions/hemorrhage, severe infections (HBV/HCV/HIV), interstitial lung disease, Child-Pugh B/C cirrhosis, live vaccines (30 days), or grade&ge;2 peripheral neuropathy (CTCAE v5.0). Systemic anti-tumor therapy within 4 weeks or CYP3A4 modifiers prohibited.

   Click to Show/Hide
Administration Dosage
On the first day of every 3 weeks, MRG003 will be administered via intravenous infusion at 2.0 mg/kg calculated based on the actual body weight
Related Clinical Trial
NCT Number NCT05188209  Clinical Status PHASE2
Clinical Description
A Phase II Clinical Study to Evaluate the Efficacy and Safety of MRG003 in EGFR-Positive, HER2-Negative Advanced Gastric Cancer.
Primary Endpoint
The primary endpoints are IRC-assessed ORR (complete/partial responses per RECIST v1.1) over 24 months and adverse events monitoring (30 days for AEs, 45 days for SAEs post-treatment) regardless of causality.
Other Endpoint
Key secondary endpoints include investigator-assessed ORR, PFS, DoR, DCR, and OS over 24 months. Pharmacokinetic analysis evaluates Cmax/AUClast for MRG003, total antibody, and MMAE (30 days post-treatment), alongside ADA immunogenicity rates.
Experiment 14 Reporting the Activity Date of This ADC [7]
Patients Enrolled
Eligible patients (18-75 years) must have PD-1/platinum-refractory metastatic head and neck squamous cell carcinoma (&le;2 prior lines), measurable lesions (RECIST v1.1), ECOG 0-1, and adequate organ function (LVEF&ge;50%). Exclusions: grade&ge;2 neuropathy, active CNS metastases, recent anti-tumor therapy (chemotherapy within 3 weeks; immunotherapy within 4 weeks), uncontrolled comorbidities (cardiac, hypertension, diabetes, HBV/HCV/HIV), recent major surgery, or effusions requiring monthly drainage. Strict contraception and pregnancy testing are mandatory.

   Click to Show/Hide
Administration Dosage
MRG003 will be administrated via intravenous infusion at 2.3 mg/kg once on Day 1 of every 3 weeks (21-day cycle).
Related Clinical Trial
NCT Number NCT05751512  Clinical Status PHASE3
Clinical Description
A Randomized, Open-Label, Multicenter, Phase III Study to Evaluate MRG003 vs Cetuximab/Methotrexate as Second/Third Line of Treatment in Patient With Recurrent or Metastatic Squamous Cell Carcinoma of the Head and Neck (RM-SCCHN)
Primary Endpoint
The primary endpoint is Overall Survival (OS), defined as the time from treatment initiation to death from any cause, measured over 24 months.
Other Endpoint
Secondary endpoints include Progression-Free Survival (PFS), Objective Response Rate (ORR), Disease Control Rate (DCR), Duration of Response (DOR), Treatment-Related Adverse Events (TRAEs), general Adverse Events (AEs), Serious Adverse Events (SAEs) with 30-90-day monitoring, and Quality of Life (QOL) assessments per RECIST v1.1, all tracked over 24 months.

   Click to Show/Hide
Experiment 15 Reporting the Activity Date of This ADC [8]
Patients Enrolled
Eligible patients (18-75 years) must have CDKN2A-deficient, PD-1/platinum-refractory recurrent/metastatic HNSCC (&le;2 prior lines), measurable lesions by RECIST v1.1, ECOG 0-1, and adequate organ function. Key exclusions: active CNS metastases, recent anti-cancer therapies (chemotherapy <3 weeks, immunotherapy <4 weeks), uncontrolled comorbidities (cardiac, HBV/HCV, HIV), uncontrolled effusions, or grade&ge;2 neuropathy. Pregnancy testing and contraception are mandatory.

   Click to Show/Hide
Administration Dosage
MRG003, intravenous infusion, D1, once every 3 weeks; Dalpicicilip, taking orally, D1-21, once every 4 weeks, maintain use until progression or emergence of intolerable toxicity.
Related Clinical Trial
NCT Number NCT06509997  Clinical Status PHASE2
Clinical Description
MRG003 Combined With Dalpicicilip Posterior Line in the Treatment of Recurrent/Metastatic CDKN2A Gene Variant Head and Neck Squamous Cell Carcinoma: A Phase II Clinical Trial
Primary Endpoint
The co-primary endpoints are Objective Response Rate (ORR) assessed by RECIST v1.1 and Safety/Tolerability measured by treatment-related adverse events (CTCAE v5.0), both evaluated approximately 9-10 weeks after treatment initiation.
Other Endpoint
Secondary endpoints include Overall Survival (OS) over 2 years, Progression-Free Survival (PFS) and Duration of Response (DOR) monitored for 1-2 years, and Disease Control Rate (DCR) assessed at 2 years.
Experiment 16 Reporting the Activity Date of This ADC [9]
Patients Enrolled
Eligible patients (18-70 years, ECOG 0-1) must have untreated, surgically resectable EGFR+ HNSCC (Stage III-IVB non-oropharyngeal or Stage II-III HPV+ oropharyngeal cancer). Key exclusions: prior HNSCC treatment, active infections (HBV/HCV/HIV), grade&ge;2 neuropathy, recent major surgery/immunotherapy, uncontrolled cardiovascular disease, autoimmune disorders requiring immunosuppressants, or history of interstitial lung disease/allogeneic transplants. Adequate organ function and contraception are required.

   Click to Show/Hide
Related Clinical Trial
NCT Number NCT06530914  Clinical Status PHASE2
Clinical Description
A Phase II Study of MRG003 Injection Combined With Pucotenlimab Injection ± Cisplatin Injection in the Neoadjuvant Treatment Locally Advanced EGFR-positive Head and Neck Squamous Cell Carcinoma
Primary Endpoint
The primary endpoint is pathological complete response (pCR) rate, evaluated post-surgery at approximately 9-10 weeks after treatment initiation.
Other Endpoint
Secondary endpoints include 1-year Event-Free Survival (EFS), Objective Response Rate (ORR) at 9-10 weeks, 2-year Overall Survival (OS), safety profiles (AE/SAE/irAE incidence per CTCAE v5.0), surgical outcomes (90-day AE/SAE rates, delays), and proportion of patients achieving clinical stage reduction after neoadjuvant therapy.
Experiment 17 Reporting the Activity Date of This ADC [10]
Patients Enrolled
Eligible patients (&ge;18 years, ECOG 0-1) must have EGFR+ advanced NSCLC (post &ge;2 prior therapies) with measurable lesions (RECIST v1.1), adequate organ function, and controlled AEs (&le;Grade 1 per CTCAE v5.0). Key exclusions: untreated CNS metastasis, active infections (HBV/HCV/HIV), severe cardiac/pulmonary disease (ILD, COPD), unresolved effusions, ongoing immunosuppressive therapy, prior EGFR-related eye/skin toxicities, or allogeneic transplants. Contraception is mandatory for patients of childbearing potential. Investigators may exclude patients with conditions compromising safety or compliance.

   Click to Show/Hide
Administration Dosage
On the first day of every 3 weeks, MRG003 will be administered via intravenous infusion at 2.0 mg/kg calculated based on the actual body weight
Related Clinical Trial
NCT Number NCT04838548  Clinical Status PHASE2
Clinical Description
An Open-Label, Multi-Cohort, Multi-center, Non-Randomized, Phase II Clinical Study to Evaluate the Efficacy and Safety of MRG003 in Patients With EGFR-Positive Advanced Non-Small Cell Lung Cancer
Primary Endpoint
The primary endpoint is Objective Response Rate (ORR) assessed per RECIST v1.1, defined as the proportion of patients achieving complete response (CR) or partial response (PR), evaluated from baseline to study completion (up to 12 months).
Other Endpoint
Secondary endpoints include Progression-Free Survival (PFS), Duration of Response (DoR), Time to Response (TTR), Disease Control Rate (DCR) (CR+PR+SD), and Overall Survival (OS), all measured over 12 months. Safety assessments involve monitoring Adverse Events (AEs) from baseline until 60 days post-treatment, including reactions, side effects, or any clinical trial events, regardless of drug-related causality.

   Click to Show/Hide
Experiment 18 Reporting the Activity Date of This ADC [11]
Efficacy Data Objective Response Rate (ORR)
40.00
44.00
0.00 %
Patients Enrolled
Patients with advanced or metastatic solid tumors who had failed outcomes from or were not able to receive standard treatment were enrolled in phase 1a without EGFR prescreening. Phase 1b recruited EGFR-positive patients with refractory advanced squamous cell carcinomas of the head and neck (SCCHN), nasopharyngeal carcinoma (NPC), and colorectal cancer (CRC).

   Click to Show/Hide
Administration Dosage
An intravenous dose of 0.10 to 2.50 mg/kg of MRG003 was administered every 3 weeks during phase 1a. During phase 1b, patients were administered the recommended dose identified in phase 1a.
Related Clinical Trial
NCT Number NCT04868344  Clinical Status Phase 1
Clinical Description
An open-label, dose-finding, phase 1 study in solid tumors.
Primary Endpoint
The MRG003 recommended dose was 2.50 mg/kg.
Other Endpoint
The objective response rates for SCCHN, NPC, and CRC were 40.00%, 44.00%, and 0.00%, and the disease control rates were 100.00%, 89.00%, and 25.00%, respectively. The median DOR of all patients was 5.60 months (SCCHN: DOR, 5.60 months; 95% CI,2.80-5.60; NPC: not estimable). The median PFS of all patients was 2.80 months (95% CI,1.20-4.10 months), and the PFS of SCCHN, NPC, and CRC was 2.80 (95% CI,0.60-6.80) months, 4.00 (95% CI, 1.20-not reached) months, and 1.20 (95% CI, 0.50-2.80) months, respectively. SCCHN cohort reached the median OS as of the data cutoff date, which was 11.80 (95% CI, 3.40-11.80) months.

   Click to Show/Hide
References
Ref 1 A Study to Evaluate the Efficacy and Safety of MRG003 in Patients With Recurrent or Metastatic Squamous Cell Carcinoma of Head and Neck
Ref 2 A Study to Evaluate the Efficacy and Safety of MRG003 in Patients With Recurrent Metastatic Nasopharyngeal Carcinoma
Ref 3 A Study of MRG003 in Patients With Advanced Solid Tumors
Ref 4 A Study of MRG003 in the Treatment of Patients With EGFR-positive Advanced or Metastatic Solid Tumors
Ref 5 A Study of MRG003 in the Treatment of EGFR-positive Unresectable, Locally Advanced or Metastatic Biliary Tract Cancer
Ref 6 A Study to Evaluate the Efficacy and Safety of MRG003 in Patients With Advanced Gastric Cancer.
Ref 7 A Study to Evaluate MRG003 vs Cetuximab/Methotrexate in in the Treatment of Patients With RM-SCCHN
Ref 8 A Phase II Study of Anti-EGFR Antibody-drug Conjugate (ADC) Combine With CDK4/6 Inhibitors Posterior Line in the Treatment of Recurrent/Metastatic CDKN2A Gene Variant Head and Neck Squamous Cell Carcinoma
Ref 9 A Phase II Study of MRG003 Injection Combined With Pucotenlimab Injection &plusmn; Cisplatin Injection in the Neoadjuvant Treatment Locally Advanced EGFR-positive Head and Neck Squamous Cell Carcinoma
Ref 10 A Study to Evaluate the Efficacy and Safety of MRG003 in Patients With EGFR-Positive Advanced Non-Small Cell Lung Cancer
Ref 11 Evaluation of Safety of Treatment With Anti-Epidermal Growth Factor Receptor Antibody Drug Conjugate MRG003 in Patients With Advanced Solid Tumors: A Phase 1 Nonrandomized Clinical Trial. JAMA Oncol. 2022 Jul 1;8(7):1042-1046.