Antibody Information
General Information of This Antibody (ID: ANTI0SFQGM)
| Antibody Name | precemtabart |
|||||
|---|---|---|---|---|---|---|
| Antigen Name | Carcinoembryonic antigen-related cell adhesion molecule 5 (CEACAM5) |
Antigen Info | ||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Sequence |
EVQLQESGPGLVKPSQTLSLTCTVSDGSVSRGGYYLTWIRQHPGKGLEWIGYIYYSGSTY
FNPSLRSRVTMSVDTSKNQFSLKLSSVTAADTAVYYCARGIAVAPFDYWGQGTLVTVSSA STKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG LYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPPVAGPS VFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNST YRVVSVLTVLHQDWLNGKEYKCKVSNKALPSSIEKTISKAKGQPREPQVYTLPPSREEMT KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQ GNVFSCSVMHEALHNHYTQKSLSLSPG Click to Show/Hide
|
|||||
| Heavy Chain Varible Domain |
EVQLQESGPGLVKPSQTLSLTCTVSDGSVSRGGYYLTWIRQHPGKGLEWIGYIYYSGSTY
FNPSLRSRVTMSVDTSKNQFSLKLSSVTAADTAVYYCARGIAVAPFDYWGQGTLVTVSSA STKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG LYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPPVAGPS VFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNST YRVVSVLTVLHQDWLNGKEYKCKVSNKALPSSIEKTISKAKGQPREPQVYTLPPSREEMT KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQ GNVFSCSVMHEALHNHYTQKSLSLSPG Click to Show/Hide
|
|||||
| Light Chain Sequence |
EIVLTQSPATLSVSPGERATLSCRTSQSVRSNLAWYQQKPGQAPRLLIYAASTRATGIPA
RFSGSGSGTEFTLTISSLQSEDFAVYYCQQYTNWPFTFGPGTKVDIKRTVAAPSVFIFPP SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Click to Show/Hide
|
|||||
| Light Chain Varible Domain |
EIVLTQSPATLSVSPGERATLSCRTSQSVRSNLAWYQQKPGQAPRLLIYAASTRATGIPA
RFSGSGSGTEFTLTISSLQSEDFAVYYCQQYTNWPFTFGPGTKVDIKRTVAAPSVFIFPP SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Click to Show/Hide
|
|||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
Precemtabart tocentecan [Phase 1/2]
Identified from the Human Clinical Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | stable disease (SD) |
55%
|
|||
| Patients Enrolled |
Eligible participants have histologically confirmed advanced/metastatic CRC refractory to standard therapies (MSI-H must have received checkpoint inhibitors if available), ECOG PS ≤1, and adequate organ function. Exclusions include other active malignancies (exceptions: non-melanoma skin/cervical cancers), unstable brain metastases, Grade >1 diarrhea/ileus, active IBD, significant cardiovascular events (MI/stroke within 6 months), or QTc >470 ms. Bowel obstruction/intestinal perforation history is also excluded.
Click to Show/Hide
|
||||
| Administration Dosage |
This Phase 1 trial (NCT05464030) investigated the safety, tolerability, pharmacokinetics (PK), and preliminary clinical activity of M9140 as monotherapy (Q3W [Day 1 of 21-day cycles]; IV), At data cutoff (19 Jan 2024), 40 pts from the US, EU, and Japan were treated across 7 dose levels (DLs): 0.6 mg/kg, 1.2 mg/kg (n=3, each), 2.4 mg/kg (n=7), 2.6 mg/kg (n=4), 2.8 mg/ kg (n=12), 3.0 mg/kg (n 4), and 3.2 mg/kg (n=7, including 3 pts with primary G CSF prophylaxis).
Click to Show/Hide
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT05464030 | Clinical Status | PHASE1 | ||
| Clinical Description |
A Phase I, Multicenter, Open-Label First in Human Study of Anti-CEACAM5 Antibody Drug Conjugate M9140 in Participants With Advanced Solid Tumors (PROCEADE-CRC-01)
|
||||
| Primary Endpoint |
This study evaluates M9140 in participants with locally advanced/metastatic colorectal cancer (CRC), divided into multiple parts. Part 1 assesses dose-limiting toxicities (DLTs) and adverse events (AEs) to determine the recommended dose expansion (RDE) over 4 months. Parts 2A, 2B, 2C, and 2D further examine safety (AEs/DLTs), objective response (OR) per RECIST v1.1, and duration of response (DoR) over 8 months.
Click to Show/Hide
|
||||
| Other Endpoint |
Pharmacokinetic (PK) analysis of M9140 plasma concentrations, anti-drug antibody (ADA) incidence/titers, ECG changes (QTc interval), and efficacy measures (OR, DoR, time to response, PFS) are assessed across all parts (1, 2A-2D). Part 2A includes overall survival (OS) and symptomatic AEs, while disease control is evaluated at Week 12.
|
||||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Partial Response (PR) |
10%
|
|||
| Patients Enrolled |
Eligible participants have histologically confirmed advanced/metastatic CRC refractory to standard therapies (MSI-H must have received checkpoint inhibitors if available), ECOG PS ≤1, and adequate organ function. Exclusions include other active malignancies (exceptions: non-melanoma skin/cervical cancers), unstable brain metastases, Grade >1 diarrhea/ileus, active IBD, significant cardiovascular events (MI/stroke within 6 months), or QTc >470 ms. Bowel obstruction/intestinal perforation history is also excluded.
Click to Show/Hide
|
||||
| Administration Dosage |
This Phase 1 trial (NCT05464030) investigated the safety, tolerability, pharmacokinetics (PK), and preliminary clinical activity of M9140 as monotherapy (Q3W [Day 1 of 21-day cycles]; IV), At data cutoff (19 Jan 2024), 40 pts from the US, EU, and Japan were treated across 7 dose levels (DLs): 0.6 mg/kg, 1.2 mg/kg (n=3, each), 2.4 mg/kg (n=7), 2.6 mg/kg (n=4), 2.8 mg/ kg (n=12), 3.0 mg/kg (n 4), and 3.2 mg/kg (n=7, including 3 pts with primary G CSF prophylaxis).
Click to Show/Hide
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT05464030 | Clinical Status | PHASE1 | ||
| Clinical Description |
A Phase I, Multicenter, Open-Label First in Human Study of Anti-CEACAM5 Antibody Drug Conjugate M9140 in Participants With Advanced Solid Tumors (PROCEADE-CRC-01)
|
||||
| Primary Endpoint |
This study evaluates M9140 in participants with locally advanced/metastatic colorectal cancer (CRC), divided into multiple parts. Part 1 assesses dose-limiting toxicities (DLTs) and adverse events (AEs) to determine the recommended dose expansion (RDE) over 4 months. Parts 2A, 2B, 2C, and 2D further examine safety (AEs/DLTs), objective response (OR) per RECIST v1.1, and duration of response (DoR) over 8 months.
Click to Show/Hide
|
||||
| Other Endpoint |
Pharmacokinetic (PK) analysis of M9140 plasma concentrations, anti-drug antibody (ADA) incidence/titers, ECG changes (QTc interval), and efficacy measures (OR, DoR, time to response, PFS) are assessed across all parts (1, 2A-2D). Part 2A includes overall survival (OS) and symptomatic AEs, while disease control is evaluated at Week 12.
|
||||
| Experiment 3 Reporting the Activity Date of This ADC | [2] | ||||
| Patients Enrolled |
Eligible participants must have histologically confirmed metastatic CRC refractory to standard therapies (fluoropyrimidine, irinotecan, platinum/EGFR/VEGF inhibitors) with ECOG PS ≤1 and adequate organ function. Key exclusions include active malignancies (exceptions: non-melanoma skin/cervical cancers), unstable brain metastases, uncontrolled diarrhea/ileus (Grade >1), or recent stroke (<6 months). MSI-H participants must have received checkpoint inhibitors unless contraindicated.
Click to Show/Hide
|
||||
| Administration Dosage |
M9140 will be administered every 3 weeks until progression, unacceptable toxicity, withdrawal of consent, or any criterion for withdrawal from the study. There will be 2 dose levels, if the low dose level is tolerated, then M9140 will be escalated to the high dose level.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06806046 | Clinical Status | PHASE1 | ||
| Clinical Description |
A Phase 1, Open-label Study of AntiCEACAM5 AntibodyDrug Conjugate M9140 in Chinese Participants With Solid Tumors (PROCEADE-CRC-02)
|
||||
| Primary Endpoint |
The study evaluates M9140 in participants with advanced/metastatic CRC, assessing dose-limiting toxicities (DLTs) during the first 21-day cycle and treatment-emergent adverse events (TEAEs) over 8 months. These primary safety endpoints will determine the tolerability profile of the investigational therapy.
|
||||
| Other Endpoint |
Pharmacokinetic (PK) assessments will characterize plasma concentrations of M9140 across multiple cycles up to treatment discontinuation (≈20 months). Efficacy outcomes include objective response (OR), duration of response (DoR), and progression-free survival (PFS) per RECIST v1.1, measured from first treatment until disease progression/death (≈8 months).
Click to Show/Hide
|
||||
| Experiment 4 Reporting the Activity Date of This ADC | [3] | ||||
| Patients Enrolled |
Eligible participants must provide informed consent, have ECOG PS ≤1, adequate organ function, and ≥1 measurable lesion per RECIST v1.1. GC substudy requires HER2-negative advanced/metastatic adenocarcinoma with 1-2 prior lines including fluoropyrimidine/platinum (and ICI for MSI-H/PD-L1+), categorized by CEACAM5 expression. NSCLC substudy enrolls stage III/IV patients with 1-3 prior lines, analyzing CEACAM5 in EGFR-mutated tumors. PDAC substudy includes 1-2 prior lines (FOLFIRINOX/nal-IRI or gem/nab-paclitaxel) with CEACAM5high expression. Key exclusions include recent malignancies (exceptions apply), unstable brain metastases, Grade >1 diarrhea/ileus, inflammatory bowel disease, significant cardiac conditions (QTc>470ms), recent stroke (<6 months), and prior irinotecan use in GC/NSCLC substudies.
Click to Show/Hide
|
||||
| Administration Dosage |
All participants will receive 2.8 milligram per kilogram (mg/kg) M9140 intravenously (i.v.) every 3 weeks (q3w) on Day 1 of consecutive 21-day cycles.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06710132 | Clinical Status | PHASE1|||PHASE2 | ||
| Clinical Description |
PROCEADE PanTumor: A Phase 1b/2, Multicenter, Open-Label Study of Anti-CEACAM5 Antibody-Drug Conjugate M9140 in Participants With Advanced Solid Tumors (Master Protocol)
|
||||
| Primary Endpoint |
The substudies in gastric cancer (GC), non-small cell lung cancer (NSCLC), and pancreatic ductal adenocarcinoma (PDAC) will assess objective response (OR) per RECIST v1.1 from first treatment through final assessment at approximately 48 months, serving as a key efficacy parameter across all three cancer types.
|
||||
| Other Endpoint |
Safety and efficacy outcomes for GC/NSCLC/PDAC substudies include adverse events (AEs), duration of response (DoR), disease control at Week 12, time to response, and progression-free survival (PFS) evaluated over 48 months. Pharmacokinetic analysis of M9140 plasma concentrations and anti-drug antibodies (ADA) will be monitored for approximately 12 months, with CEACAM5 expression specifically measured in the GC substudy on Day 1.
Click to Show/Hide
|
||||
References
