General Information of This Antibody (ID: ANTI0SFQGM)
Antibody Name
precemtabart
Antigen Name
Carcinoembryonic antigen-related cell adhesion molecule 5 (CEACAM5)
 Antigen Info 
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence
EVQLQESGPGLVKPSQTLSLTCTVSDGSVSRGGYYLTWIRQHPGKGLEWIGYIYYSGSTY
FNPSLRSRVTMSVDTSKNQFSLKLSSVTAADTAVYYCARGIAVAPFDYWGQGTLVTVSSA
STKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG
LYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPPVAGPS
VFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNST
YRVVSVLTVLHQDWLNGKEYKCKVSNKALPSSIEKTISKAKGQPREPQVYTLPPSREEMT
KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQ
GNVFSCSVMHEALHNHYTQKSLSLSPG
    Click to Show/Hide
Heavy Chain Varible Domain
EVQLQESGPGLVKPSQTLSLTCTVSDGSVSRGGYYLTWIRQHPGKGLEWIGYIYYSGSTY
FNPSLRSRVTMSVDTSKNQFSLKLSSVTAADTAVYYCARGIAVAPFDYWGQGTLVTVSSA
STKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG
LYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPPVAGPS
VFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNST
YRVVSVLTVLHQDWLNGKEYKCKVSNKALPSSIEKTISKAKGQPREPQVYTLPPSREEMT
KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQ
GNVFSCSVMHEALHNHYTQKSLSLSPG
    Click to Show/Hide
Light Chain Sequence
EIVLTQSPATLSVSPGERATLSCRTSQSVRSNLAWYQQKPGQAPRLLIYAASTRATGIPA
RFSGSGSGTEFTLTISSLQSEDFAVYYCQQYTNWPFTFGPGTKVDIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
    Click to Show/Hide
Light Chain Varible Domain
EIVLTQSPATLSVSPGERATLSCRTSQSVRSNLAWYQQKPGQAPRLLIYAASTRATGIPA
RFSGSGSGTEFTLTISSLQSEDFAVYYCQQYTNWPFTFGPGTKVDIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
    Click to Show/Hide
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
Precemtabart tocentecan [Phase 1/2]
Identified from the Human Clinical Data
Click To Hide/Show 4 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data stable disease (SD)
55%
Patients Enrolled
Eligible participants have histologically confirmed advanced/metastatic CRC refractory to standard therapies (MSI-H must have received checkpoint inhibitors if available), ECOG PS ≤1, and adequate organ function. Exclusions include other active malignancies (exceptions: non-melanoma skin/cervical cancers), unstable brain metastases, Grade >1 diarrhea/ileus, active IBD, significant cardiovascular events (MI/stroke within 6 months), or QTc >470 ms. Bowel obstruction/intestinal perforation history is also excluded.

   Click to Show/Hide
Administration Dosage
This Phase 1 trial (NCT05464030) investigated the safety, tolerability, pharmacokinetics (PK), and preliminary clinical activity of M9140 as monotherapy (Q3W [Day 1 of 21-day cycles]; IV), At data cutoff (19 Jan 2024), 40 pts from the US, EU, and Japan were treated across 7 dose levels (DLs): 0.6 mg/kg, 1.2 mg/kg (n=3, each), 2.4 mg/kg (n=7), 2.6 mg/kg (n=4), 2.8 mg/ kg (n=12), 3.0 mg/kg (n 4), and 3.2 mg/kg (n=7, including 3 pts with primary G CSF prophylaxis).

   Click to Show/Hide
Related Clinical Trial
NCT Number NCT05464030  Clinical Status PHASE1
Clinical Description
A Phase I, Multicenter, Open-Label First in Human Study of Anti-CEACAM5 Antibody Drug Conjugate M9140 in Participants With Advanced Solid Tumors (PROCEADE-CRC-01)
Primary Endpoint
This study evaluates M9140 in participants with locally advanced/metastatic colorectal cancer (CRC), divided into multiple parts. Part 1 assesses dose-limiting toxicities (DLTs) and adverse events (AEs) to determine the recommended dose expansion (RDE) over 4 months. Parts 2A, 2B, 2C, and 2D further examine safety (AEs/DLTs), objective response (OR) per RECIST v1.1, and duration of response (DoR) over 8 months.

   Click to Show/Hide
Other Endpoint
Pharmacokinetic (PK) analysis of M9140 plasma concentrations, anti-drug antibody (ADA) incidence/titers, ECG changes (QTc interval), and efficacy measures (OR, DoR, time to response, PFS) are assessed across all parts (1, 2A-2D). Part 2A includes overall survival (OS) and symptomatic AEs, while disease control is evaluated at Week 12.
Experiment 2 Reporting the Activity Date of This ADC [1]
Efficacy Data Partial Response (PR)
10%
Patients Enrolled
Eligible participants have histologically confirmed advanced/metastatic CRC refractory to standard therapies (MSI-H must have received checkpoint inhibitors if available), ECOG PS ≤1, and adequate organ function. Exclusions include other active malignancies (exceptions: non-melanoma skin/cervical cancers), unstable brain metastases, Grade >1 diarrhea/ileus, active IBD, significant cardiovascular events (MI/stroke within 6 months), or QTc >470 ms. Bowel obstruction/intestinal perforation history is also excluded.

   Click to Show/Hide
Administration Dosage
This Phase 1 trial (NCT05464030) investigated the safety, tolerability, pharmacokinetics (PK), and preliminary clinical activity of M9140 as monotherapy (Q3W [Day 1 of 21-day cycles]; IV), At data cutoff (19 Jan 2024), 40 pts from the US, EU, and Japan were treated across 7 dose levels (DLs): 0.6 mg/kg, 1.2 mg/kg (n=3, each), 2.4 mg/kg (n=7), 2.6 mg/kg (n=4), 2.8 mg/ kg (n=12), 3.0 mg/kg (n 4), and 3.2 mg/kg (n=7, including 3 pts with primary G CSF prophylaxis).

   Click to Show/Hide
Related Clinical Trial
NCT Number NCT05464030  Clinical Status PHASE1
Clinical Description
A Phase I, Multicenter, Open-Label First in Human Study of Anti-CEACAM5 Antibody Drug Conjugate M9140 in Participants With Advanced Solid Tumors (PROCEADE-CRC-01)
Primary Endpoint
This study evaluates M9140 in participants with locally advanced/metastatic colorectal cancer (CRC), divided into multiple parts. Part 1 assesses dose-limiting toxicities (DLTs) and adverse events (AEs) to determine the recommended dose expansion (RDE) over 4 months. Parts 2A, 2B, 2C, and 2D further examine safety (AEs/DLTs), objective response (OR) per RECIST v1.1, and duration of response (DoR) over 8 months.

   Click to Show/Hide
Other Endpoint
Pharmacokinetic (PK) analysis of M9140 plasma concentrations, anti-drug antibody (ADA) incidence/titers, ECG changes (QTc interval), and efficacy measures (OR, DoR, time to response, PFS) are assessed across all parts (1, 2A-2D). Part 2A includes overall survival (OS) and symptomatic AEs, while disease control is evaluated at Week 12.
Experiment 3 Reporting the Activity Date of This ADC [2]
Patients Enrolled
Eligible participants must have histologically confirmed metastatic CRC refractory to standard therapies (fluoropyrimidine, irinotecan, platinum/EGFR/VEGF inhibitors) with ECOG PS &le;1 and adequate organ function. Key exclusions include active malignancies (exceptions: non-melanoma skin/cervical cancers), unstable brain metastases, uncontrolled diarrhea/ileus (Grade >1), or recent stroke (<6 months). MSI-H participants must have received checkpoint inhibitors unless contraindicated.

   Click to Show/Hide
Administration Dosage
M9140 will be administered every 3 weeks until progression, unacceptable toxicity, withdrawal of consent, or any criterion for withdrawal from the study. There will be 2 dose levels, if the low dose level is tolerated, then M9140 will be escalated to the high dose level.
Related Clinical Trial
NCT Number NCT06806046  Clinical Status PHASE1
Clinical Description
A Phase 1, Open-label Study of AntiCEACAM5 AntibodyDrug Conjugate M9140 in Chinese Participants With Solid Tumors (PROCEADE-CRC-02)
Primary Endpoint
The study evaluates M9140 in participants with advanced/metastatic CRC, assessing dose-limiting toxicities (DLTs) during the first 21-day cycle and treatment-emergent adverse events (TEAEs) over 8 months. These primary safety endpoints will determine the tolerability profile of the investigational therapy.
Other Endpoint
Pharmacokinetic (PK) assessments will characterize plasma concentrations of M9140 across multiple cycles up to treatment discontinuation (≈20 months). Efficacy outcomes include objective response (OR), duration of response (DoR), and progression-free survival (PFS) per RECIST v1.1, measured from first treatment until disease progression/death (≈8 months).

   Click to Show/Hide
Experiment 4 Reporting the Activity Date of This ADC [3]
Patients Enrolled
Eligible participants must provide informed consent, have ECOG PS &le;1, adequate organ function, and &ge;1 measurable lesion per RECIST v1.1. GC substudy requires HER2-negative advanced/metastatic adenocarcinoma with 1-2 prior lines including fluoropyrimidine/platinum (and ICI for MSI-H/PD-L1+), categorized by CEACAM5 expression. NSCLC substudy enrolls stage III/IV patients with 1-3 prior lines, analyzing CEACAM5 in EGFR-mutated tumors. PDAC substudy includes 1-2 prior lines (FOLFIRINOX/nal-IRI or gem/nab-paclitaxel) with CEACAM5high expression. Key exclusions include recent malignancies (exceptions apply), unstable brain metastases, Grade >1 diarrhea/ileus, inflammatory bowel disease, significant cardiac conditions (QTc>470ms), recent stroke (<6 months), and prior irinotecan use in GC/NSCLC substudies.

   Click to Show/Hide
Administration Dosage
All participants will receive 2.8 milligram per kilogram (mg/kg) M9140 intravenously (i.v.) every 3 weeks (q3w) on Day 1 of consecutive 21-day cycles.
Related Clinical Trial
NCT Number NCT06710132  Clinical Status PHASE1|||PHASE2
Clinical Description
PROCEADE PanTumor: A Phase 1b/2, Multicenter, Open-Label Study of Anti-CEACAM5 Antibody-Drug Conjugate M9140 in Participants With Advanced Solid Tumors (Master Protocol)
Primary Endpoint
The substudies in gastric cancer (GC), non-small cell lung cancer (NSCLC), and pancreatic ductal adenocarcinoma (PDAC) will assess objective response (OR) per RECIST v1.1 from first treatment through final assessment at approximately 48 months, serving as a key efficacy parameter across all three cancer types.
Other Endpoint
Safety and efficacy outcomes for GC/NSCLC/PDAC substudies include adverse events (AEs), duration of response (DoR), disease control at Week 12, time to response, and progression-free survival (PFS) evaluated over 48 months. Pharmacokinetic analysis of M9140 plasma concentrations and anti-drug antibodies (ADA) will be monitored for approximately 12 months, with CEACAM5 expression specifically measured in the GC substudy on Day 1.

   Click to Show/Hide
References
Ref 1 Anti-CEACAM5 ADC M9140 in Advanced Solid Tumors (PROCEADE-CRC-01)
Ref 2 Anti-CEACAM5 ADC M9140 in Chinese Participants With Solid Tumors (PROCEADE-CRC-02)
Ref 3 Study of Anti-CEACAM5 ADC M9140 in Participants With Advanced Solid Tumors (PROCEADE PanTumor)