Antibody ID	ANTI0RSERE
Antibody Name	Antibody 1
Synonyms	Antibody 1    Click to Show/Hide
Antibody Type	Monoclonal antibody (mAb)
Antibody Subtype	Humanized lgG1
Antigen Name	Syndecan-1 (SDC1)					Antigen Info
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Varible Domain	QVQLQQSGSELMMPGASVKISCKATGYTESNYWIEWVKQRPGHGLEWIGEILPGTGRTIY NEKFKGKATFTADISSNTVOMQLSSLTSEDSAVYYCARRDYYGNFYYAMDYWGOGTLVTV SS     Click to Show/Hide
Heavy Chain CDR 1	NYWIE     Click to Show/Hide
Heavy Chain CDR 2	EILPGTGRTIYNEKFKG     Click to Show/Hide
Heavy Chain CDR 3	RDYYGNFYYAMDY     Click to Show/Hide
Light Chain Varible Domain	DIQMTQSTSSLSASLGDRVTISCSASQGINNYINWYQOKPDGTVELLIYYTSTLOSGVPS RFSGSGSGTDYSLTISNLEPEDIGTYYCOOYSKLPRTFGGGTKLEIK     Click to Show/Hide
Light Chain CDR 1	SASQGINNYLN     Click to Show/Hide
Light Chain CDR 2	YTSTLQS     Click to Show/Hide
Light Chain CDR 3	QQYSKLPRT     Click to Show/Hide

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Tumor Growth lnhibition value (TGl)	≈ 85%	Positive CD138 expression (CD138+++/++)
Method Description	1x107cells/100 uL, ADC3 at 1 mg/kg, intravenous injection,
In Vivo Model	Capan-1 derived Xenograft Model
Experiment 2 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Tumor Growth lnhibition value (TGl)	≈ 98%	Positive CD138 expression (CD138+++/++)
Method Description	1x107cells/100 uL, ADC3 at 1 mg/kg, intravenous injection,
In Vivo Model	Capan-1 derived Xenograft Model

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	13 ng/mL	Positive CD138 expression (CD138+++/++)
Method Description	1000 cells/well of Capan-1 in 96 well, 37 °C for 5 days.
In Vitro Model	Pancreatic ductal adenocarcinoma	Capan-1 cells		CVCL_0237
Experiment 2 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	2357 ng/mL	Negative CD138 expression (CD138-)
Method Description	1000 cells/well of Jurkat in 96 well, 37 °C for 5 days.
In Vitro Model	T acute lymphoblastic leukemia	Jurkat cells		CVCL_0065

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	10 ng/mL	Negative CD138 expression (CD138-)
Method Description	1000 cells/well of Jurkat in 96 well, 37 °C for 5 days.
In Vitro Model	T acute lymphoblastic leukemia	Jurkat cells		CVCL_0065
Experiment 2 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	20 ng/mL	Positive CD138 expression (CD138+++/++)
Method Description	1000 cells/well of Capan-1 in 96 well, 37 °C for 5 days.
In Vitro Model	Pancreatic ductal adenocarcinoma	Capan-1 cells		CVCL_0237

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	165 ng/mL	Positive CD138 expression (CD138+++/++)
Method Description	1000 cells/well of Capan-1 in 96 well, 37 °C for 5 days.
In Vitro Model	Pancreatic ductal adenocarcinoma	Capan-1 cells		CVCL_0237
Experiment 2 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	> 10000 ng/mL	Negative CD138 expression (CD138-)
Method Description	1000 cells/well of Jurkat in 96 well, 37 °C for 5 days.
In Vitro Model	T acute lymphoblastic leukemia	Jurkat cells		CVCL_0065

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	2016 ng/mL	Negative CD138 expression (CD138-)
Method Description	1000 cells/well of Jurkat in 96 well, 37 °C for 5 days.
In Vitro Model	T acute lymphoblastic leukemia	Jurkat cells		CVCL_0065
Experiment 2 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	> 10000 ng/mL	Positive CD138 expression (CD138+++/++)
Method Description	1000 cells/well of Capan-1 in 96 well, 37 °C for 5 days.
In Vitro Model	Pancreatic ductal adenocarcinoma	Capan-1 cells		CVCL_0237

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	7996 ng/mL	Negative CD138 expression (CD138-)
Method Description	1000 cells/well of Jurkat in 96 well, 37 °C for 5 days.
In Vitro Model	T acute lymphoblastic leukemia	Jurkat cells		CVCL_0065
Experiment 2 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	8385 ng/mL	Positive CD138 expression (CD138+++/++)
Method Description	1000 cells/well of Capan-1 in 96 well, 37 °C for 5 days.
In Vitro Model	Pancreatic ductal adenocarcinoma	Capan-1 cells		CVCL_0237

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	> 10000 ng/mL	Positive CD138 expression (CD138+++/++)
Method Description	1000 cells/well of Capan-1 in 96 well, 37 °C for 5 days.
In Vitro Model	Pancreatic ductal adenocarcinoma	Capan-1 cells		CVCL_0237
Experiment 2 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	> 10000 ng/mL	Negative CD138 expression (CD138-)
Method Description	1000 cells/well of Jurkat in 96 well, 37 °C for 5 days.
In Vitro Model	T acute lymphoblastic leukemia	Jurkat cells		CVCL_0065

Ref 1	Antibody-drug complexes containing anti-CD138 antibodies