General Information of This Antibody (ID: ANTI0RILNJ)
Antibody Name
TPP-9574
Organization
BAYER PHARMA AKTIENGESELLSCHAFT
Synonyms
TPP-9574
   Click to Show/Hide
Antigen Name
C-X-C chemokine receptor type 5 (CXCR5)
 Antigen Info 
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence
EVOLVESGGGLIQPGGSLRLSCAASGFTFSTSGMHWFRQAPGKGLEWVAYISSSSGFVYA
DAVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARSEAAFWGQGTLVTVSSASTKGPS
VFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLOSSGLYSLSS
VVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFP
PKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVS
VLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVS
LTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS
CSVMHEALHNHYTQKSLSLSPG
    Click to Show/Hide
Heavy Chain Varible Domain
EVOLVESGGGLIQPGGSLRLSCAASGFTFSTSGMHWFRQAPGKGLEWVAYISSSSGFVYA
DAVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARSEAAFWGQGTLVTVSS
    Click to Show/Hide
Heavy Chain CDR 1
TSGMH
    Click to Show/Hide
Heavy Chain CDR 2
YISSSSGFVYADAVKG
    Click to Show/Hide
Heavy Chain CDR 3
SEAAF
    Click to Show/Hide
Light Chain Sequence
DIVMTQSPLSLPVTPGEPASISCRSQKSRLSRMGITPLNWYLQKPGQSPQLLIYRMSNLA
SGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCAQFLEYPPTFGQGTKLEIKRTVAAPSV
FIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSL
SSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
    Click to Show/Hide
Light Chain Varible Domain
DIVMTQSPLSLPVTPGEPASISCRSQKSRLSRMGITPLNWYLQKPGQSPQLLIYRMSNLA
SGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCAQFLEYPPTFGQGTKLEIK
    Click to Show/Hide
Light Chain CDR 1
RSQKSRLSRMGITPLN
    Click to Show/Hide
Light Chain CDR 2
RMSNLAS
    Click to Show/Hide
Light Chain CDR 3
AQFLEYPPT
    Click to Show/Hide
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
CN110072556B 1x-9574 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
0.0294 nM
Positive CXCR5 expression (CXCR5+++/++)
Method Description
Cell line Rec-1 were plated at set initial densities in 96-well culture plate with white bottom in the appropriate growth media. 48hours later, the medium was replaced. The ADCs in 10 ul of culture medium inconcentrations from 10-5M to 10-13M were then pipetted to the cells. After 6 hours of incubation at 37°C and 5%carbon dioxide, the medium was changed and the antibody-drug conjugates or metabolites were added by pipette in 10 ul of culture medium in concentrations of 10-5M to 10-13M to the cells (triplicates) in 90 ul. After 96 h, the cell proliferation was detected using the MTT assay (ATCC, Manassas, Virginia, USA, catalogue No. 30-1010K). To this end, the MTT reagent was incubated with the cells for 4 h, followed by lysis of the cells overnight byaddition of the detergent. The dye formed was detected at 570 nm (Infinite M1000 proTecan). The measured data were used to calculate the ICso of the growth inhibition usingthe DRC (dose response curve). The proliferation of cells which were not treated with testsubstance but were otherwise identically treated was defined as the 100% figure.

   Click to Show/Hide
In Vitro Model Mantle cell lymphoma REC-1 cells CVCL_1884
R1x-9574 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
0.262 nM
Positive CXCR5 expression (CXCR5+++/++)
Method Description
Cell line Rec-1 were plated at set initial densities in 96-well culture plate with white bottom in the appropriate growth media. 48hours later, the medium was replaced. The ADCs in 10 ul of culture medium inconcentrations from 10-5M to 10-13M were then pipetted to the cells. After 6 hours of incubation at 37°C and 5%carbon dioxide, the medium was changed and the antibody-drug conjugates or metabolites were added by pipette in 10 ul of culture medium in concentrations of 10-5M to 10-13M to the cells (triplicates) in 90 ul. After 96 h, the cell proliferation was detected using the MTT assay (ATCC, Manassas, Virginia, USA, catalogue No. 30-1010K). To this end, the MTT reagent was incubated with the cells for 4 h, followed by lysis of the cells overnight byaddition of the detergent. The dye formed was detected at 570 nm (Infinite M1000 proTecan). The measured data were used to calculate the ICso of the growth inhibition usingthe DRC (dose response curve). The proliferation of cells which were not treated with testsubstance but were otherwise identically treated was defined as the 100% figure.

   Click to Show/Hide
In Vitro Model Mantle cell lymphoma REC-1 cells CVCL_1884
References
Ref 1 Specific antibody-drug conjugates (ADCs) having KSP inhibitors