General Information of This Antibody (ID: ANTI0QVRLC)
Antibody Name
P015004
Organization
AIMED BIO INC.
Synonyms
P015004
   Click to Show/Hide
Antigen Name
Inactive tyrosine-protein kinase transmembrane receptor ROR1 (ROR1)
 Antigen Info 
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Varible Domain
EVQLLESGGGLVQPGGSLRLSCAASGFTFSDYAMAWVRQAPGKGLEWVSIIYPGDSETIY
SPSFEGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDTYWEGYFDLWGQGTLVTVSS
    Click to Show/Hide
Heavy Chain CDR 1
DYAMA
    Click to Show/Hide
Heavy Chain CDR 2
IIYPGDSETIYSPSFEG
    Click to Show/Hide
Heavy Chain CDR 3
RDTYWEGYFDL
    Click to Show/Hide
Light Chain Varible Domain
EIVLTQSPGTLSLSPGERATLSCRASQGISNYLAWYQQKPGQAPRLLIYDASNLESGIPD
RFSGSGSGTDFTLTISRLEPEDFAVYYCQQYANLPYTFGQGTKVEIK
    Click to Show/Hide
Light Chain CDR 1
RASQGISNYLA
    Click to Show/Hide
Light Chain CDR 2
DASNLES
    Click to Show/Hide
Light Chain CDR 3
QQYANLPYT
    Click to Show/Hide
The Activity Data of This Antibody
Antibody Activity Information 1 [1]
Half Maximal Effective Concentration (EC50)
4.6
nM
U266 (CD38-) cells
Antigen Expression High ROR1 expression ( ROR1 +++)
Antibody Function P015004 bound to AMB-LC-0003T cells
Antibody Antigen Binding Assay Each antibody was serially diluted 10-fold from 100 nM to 10 nM, 1 nM, 100 pM, 10 pM, and 1 pM and the cells were treated therewith. After reaction at 4°C for 30 minutes, washing was performed twice. PE labeled goat anti-human IgG Fc PE (ThermoFisher; 12-4998-82) as a secondary antibody was diluted at a ratio of 1:100 in FACS buffer, and 100 pl thereof was dispensed per well. Reaction again at 4°C for 30 minutes and washing twice were performed. Finally, 100 pl of FACS buffer was dispensed per well, followed by mixing well with a pipette and then flow cytometry using a NovoCyte flow cytometer (Agilent). Analysis was performed using GraphPad Prism 9.3.1, and EC5o values were obtained using a log (agonist) vs. response - Variable slope nonlinear graph model.
Antibody Activity Information 2 [1]
Half Maximal Effective Concentration (EC50)
4.6
nM
U266 (CD38-) cells
Antigen Expression High ROR1 expression ( ROR1 +++)
Antibody Function P015004 bound to AMB-LC-0003T cells
Antibody Antigen Binding Assay Each antibody was serially diluted 10-fold from 100 nM to 10 nM, 1 nM, 100 pM, 10 pM, and 1 pM and the cells were treated therewith. After reaction at 4°C for 30 minutes, washing was performed twice. PE labeled goat anti-human IgG Fc PE (ThermoFisher; 12-4998-82) as a secondary antibody was diluted at a ratio of 1:100 in FACS buffer, and 100 pl thereof was dispensed per well. Reaction again at 4°C for 30 minutes and washing twice were performed. Finally, 100 pl of FACS buffer was dispensed per well, followed by mixing well with a pipette and then flow cytometry using a NovoCyte flow cytometer (Agilent). Analysis was performed using GraphPad Prism 9.3.1, and EC5o values were obtained using a log (agonist) vs. response - Variable slope nonlinear graph model.
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
P015004-vc-PAB-MMAE [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 2 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
10.62 nM
High ROR1 expression ( ROR1 +++)
Method Description
In each ultra-low attachment U bottom 384-well transparent plate patient-derived lung cancer cells AMB-LC-0003T were dispensed in triplicate at 500 cells/well in 40 p1l of M10018 (Aimedbio) media. After centrifugation at 250 g for 2 minutes, reaction was carried out at 37°C and 5% Co 2 for 24 hours. Thereafter, each antibody-drug conjugate was serially diluted 3-fold from 500 nM to 0.314 pM and the cells were treated therewith. The plate was reacted again at 37°C and 5% Co2 for 6 days. After a total of 7 days of reaction, spheroids were formed by the cells in the 384-well plate, so images of spheroids in each well were captured using Operetta CLS (PerkinElmer) according to a high-content screening method. To maintain the spheroid form of the cells in each well, washing was not performed before analysis. The captured images were converted into volume through additional analysis, and the spheroid volume values by concentration were standardized based on the spheroid treated with the lowest concentration of drug. Graphs were created with a log (inhibitor) vs. normalized response - Variable slope using GraphPad Prism 9.3.1, and IC5 o values were obtained.

   Click to Show/Hide
In Vitro Model lung cancer AMB-LC-0003T cells Homo sapiens
Experiment 2 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
159.5 nM
Low ROR1 expression (ROR1+)
Method Description
In each ultra-low attachment U bottom 384-well transparent plate patient-derived lung cancer cells AMB-LC-0003T were dispensed in triplicate at 500 cells/well in 40 p1l of M10018 (Aimedbio) media. After centrifugation at 250 g for 2 minutes, reaction was carried out at 37°C and 5% Co 2 for 24 hours. Thereafter, each antibody-drug conjugate was serially diluted 3-fold from 500 nM to 0.314 pM and the cells were treated therewith. The plate was reacted again at 37°C and 5% Co2 for 6 days. After a total of 7 days of reaction, spheroids were formed by the cells in the 384-well plate, so images of spheroids in each well were captured using Operetta CLS (PerkinElmer) according to a high-content screening method. To maintain the spheroid form of the cells in each well, washing was not performed before analysis. The captured images were converted into volume through additional analysis, and the spheroid volume values by concentration were standardized based on the spheroid treated with the lowest concentration of drug. Graphs were created with a log (inhibitor) vs. normalized response - Variable slope using GraphPad Prism 9.3.1, and IC5 o values were obtained.

   Click to Show/Hide
In Vitro Model lung cancer AMB-LC-0003T cells Homo sapiens
References
Ref 1 Anti-ror1 antibodies and their uses