Antibody Information
General Information of This Antibody
| Antibody ID | ANTI0QULTE |
|||||
|---|---|---|---|---|---|---|
| Antibody Name | FR-alpha antibody |
|||||
| Organization | Bio-Thera Solutions, Ltd. |
|||||
| Synonyms |
FR-alpha antibody
Click to Show/Hide
|
|||||
| Antibody Type | Monoclonal antibody (mAb) |
|||||
| Antibody Subtype | Humanized lgG |
|||||
| Antigen Name | Folate receptor alpha (FOLR1) |
Antigen Info | ||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Sequence |
QVQLVQSGVEVKKPGASVKVSCKASGYSFTGYFMNWVRQAPGQGLEWIGRIHPYDGDTFY
NQNFKDKATLTVDKSTTTAYMELKSLQFDDTAVYYCTRYDGSRAMDYWGQGTTVTVSSAS TKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGL YSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPS VFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNST YRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELT KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQ GNVFSCSVMHEALHNHYTQKSLSLSPGK Click to Show/Hide
|
|||||
| Light Chain Sequence |
EIVLTQSPATLSLSPGERATLSCKASQSVSFAGTSLMHWYQQKPGQAPRLLIYRASNLEA
GVPARFSGSGSKTDFTLTISSLEPEDFAVYYCQQSREYPYTFGGGTKVEIKRTVAAPSVF IFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLS STLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Click to Show/Hide
|
|||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
CN115429893A ADC16 [Investigative]
Discovered Using Cell Line-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth lnhibition value (TGl) |
86.81%
|
Positive FR-alpha expression (FR-alpha+++/++) | ||
| Method Description |
In the OV3756 xenograft model, the ADCs were administered at 2.5 mg/kg (once, IV).
|
||||
| In Vivo Model | OV3756 xenograft model | ||||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth lnhibition value (TGl) |
86.81%
|
Positive FR-alpha expression (FR-alpha+++/++) | ||
| Method Description |
In the OV3756 xenograft model, the ADCs were administered at 2.5 mg/kg (once, IV).
|
||||
| In Vivo Model | OV3756 xenograft model | ||||
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.645 nM
|
Positive FR-alpha expression (FR-alpha+++/++) | ||
| Method Description |
MCF-7 cells were seeded in 96-well cell culture plates for 24 hours before treatment. Cells were treated with ADC16 (4x the first top concentration at 250 nM) for 5 days.
|
||||
| In Vitro Model | Invasive breast carcinoma | MCF-7 cells | CVCL_0031 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.645 nM
|
Positive FR-alpha expression (FR-alpha+++/++) | ||
| Method Description |
MCF-7 cells were seeded in 96-well cell culture plates for 24 hours before treatment. Cells were treated with ADC16 (4x the first top concentration at 250 nM) for 5 days.
|
||||
| In Vitro Model | Invasive breast carcinoma | MCF-7 cells | CVCL_0031 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
3.611 nM
|
Positive FR-alpha expression (FR-alpha+++/++) | ||
| Method Description |
JEG-3 cells were seeded in 96-well cell culture plates for 24 hours before treatment. Cells were treated with ADC16 (4x the first top concentration at 1000 nM) for 5 days.
|
||||
| In Vitro Model | Gestational choriocarcinoma | JEG-3 cells | CVCL_0363 | ||
| Experiment 4 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
3.611 nM
|
Positive FR-alpha expression (FR-alpha+++/++) | ||
| Method Description |
JEG-3 cells were seeded in 96-well cell culture plates for 24 hours before treatment. Cells were treated with ADC16 (4x the first top concentration at 1000 nM) for 5 days.
|
||||
| In Vitro Model | Gestational choriocarcinoma | JEG-3 cells | CVCL_0363 | ||