General Information of This Antibody
Antibody ID
ANTI0QPIIF
Antibody Name
2E7
Organization
PROFOUNDBIO US CO.
Synonyms
2E7 Antibody
   Click to Show/Hide
Antigen Name
CD70 antigen (CD70)
 Antigen Info 
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Varible Domain
OVOLOESGPGLVKPSETLSLTCTVSGGSVSSDYYYWSWIROPPGKGLEWLGYIYYSGSTN
YNPSLKSRVTISVDTSKNOFSLKLRSVTTADTAVYYCARGDGDFLGVCFDYWGOGTLVTV
SS
    Click to Show/Hide
Heavy Chain CDR 1
SSDYYYWS
    Click to Show/Hide
Heavy Chain CDR 2
YIYYSGSTNYNPSLKS
    Click to Show/Hide
Heavy Chain CDR 3
GDGDFLGVCFDY
    Click to Show/Hide
Light Chain Varible Domain
EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIFDASNRATGIPA
RFSGSGSGTDFTLTISSLEPEDFAVYYCQQRSNWPLTFGGGTKVEIK
    Click to Show/Hide
Light Chain CDR 1
RATLSCRASQSVSSYLA
    Click to Show/Hide
Light Chain CDR 2
DASNRAT
    Click to Show/Hide
Light Chain CDR 3
QQRSNWPLT
    Click to Show/Hide
The Activity Data of This Antibody
Antibody Activity Information 1 [1]
Half Maximal Effective Concentration (EC50)
1.59
M
Caki-1 cells CVCL_0234 
Antibody Function 2E7 bound to Caki-1 cells
Antibody Antigen Binding Assay 3X10<sup>5</sup> cells were incubatedat 4&deg;C for 30 min with 10 g/ml 2E7 antibody in FACS buffer (1X PBScontaining 0.1%% BSA). Cells were washed at 4&deg;C to remove unbound material and kept on ice or shifted to 37&deg;C for different lengths of time as needed. At progressive timepoints (Ohr, 0.shr, lhr, 2hr, 3hr, 4 hr)cells were stained with PE-conjugated anti-human Fc for 30 min at 4&deg;C and analyzed by flow cytometry. Intemalization rate were calculated by subtracting the mean fluorescence intensity (MFl) of cell surface-bound antibody at 37'C at each time point from the MFI of cell surface-bound antibody at 4&deg;C at time 0.
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
WO2024092067A1 ADC 2E7-LD038 (PA038) [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 3 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
36 nM
Moderate CD70 expression (CD70++)
Method Description
Cell Raji were cultured in CO2, thermostatic incubator at 37°C with 5% CO2, in standard conditions. Cells were sub-cultured every 1-2 days, digested with 0.25% trypsin and passaged with a suitable density. When the cells were in the logarithmic growth phase and the amount meeting the assay's demand, cells were collectedand plated onto 96-well solid white flat bottom plates for assay. One day later test articles 2E7-LD038 conjugate ranging from 2 uM to 0.1nM, or extecan ranging from 20 uM to 0.03 nM were added to the cells. Plates were then incubated at 37°C for 96h. Cell Titer Glo (CTG) (40 ul per well) was subsequently added to the plates. Luciferase reading was collected 5min after and analyzed by Microplatereaders. All readings were normalized as percentage of viable cells in the untreated control wells and theICso yalues were calculated by Prism software.

   Click to Show/Hide
In Vitro Model EBV-related Burkitt lymphoma Raji cells CVCL_0511
Experiment 2 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
37 nM
Method Description
Cell Caki-1 were cultured in CO2, thermostatic incubator at 37°C with 5% CO2, in standard conditions. Cells were sub-cultured every 1-2 days, digested with 0.25% trypsin and passaged with a suitable density. When the cells were in the logarithmic growth phase and the amount meeting the assay's demand, cells were collectedand plated onto 96-well solid white flat bottom plates for assay. One day later test articles 2E7-LD038 conjugate ranging from 2 uM to 0.1nM, or extecan ranging from 20 uM to 0.03 nM were added to the cells. Plates were then incubated at 37°C for 96h. Cell Titer Glo (CTG) (40 ul per well) was subsequently added to the plates. Luciferase reading was collected 5min after and analyzed by Microplatereaders. All readings were normalized as percentage of viable cells in the untreated control wells and theICso yalues were calculated by Prism software.

   Click to Show/Hide
In Vitro Model Clear cell renal cell carcinoma Caki-1 cells CVCL_0234
Experiment 3 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
292 nM
Method Description
Cell 786-O were cultured in CO2, thermostatic incubator at 37°C with 5% CO2, in standard conditions. Cells were sub-cultured every 1-2 days, digested with 0.25% trypsin and passaged with a suitable density. When the cells were in the logarithmic growth phase and the amount meeting the assay's demand, cells were collectedand plated onto 96-well solid white flat bottom plates for assay. One day later test articles 2E7-LD038 conjugate ranging from 2 uM to 0.1nM, or extecan ranging from 20 uM to 0.03 nM were added to the cells. Plates were then incubated at 37°C for 96h. Cell Titer Glo (CTG) (40 ul per well) was subsequently added to the plates. Luciferase reading was collected 5min after and analyzed by Microplatereaders. All readings were normalized as percentage of viable cells in the untreated control wells and theICso yalues were calculated by Prism software.

   Click to Show/Hide
In Vitro Model Renal cell carcinoma 786-O cells CVCL_1051
References
Ref 1 CD70 antibody drug conjugates and methods of using the same