Antibody Information
General Information of This Antibody (ID: ANTI0QPIIF)
| Antibody Name | 2.00E+07 |
|||||
|---|---|---|---|---|---|---|
| Organization | PROFOUNDBIO US CO. |
|||||
| Synonyms |
2E7 Antibody
Click to Show/Hide
|
|||||
| Antigen Name | CD70 antigen (CD70) |
Antigen Info | ||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Varible Domain |
OVOLOESGPGLVKPSETLSLTCTVSGGSVSSDYYYWSWIROPPGKGLEWLGYIYYSGSTN
YNPSLKSRVTISVDTSKNOFSLKLRSVTTADTAVYYCARGDGDFLGVCFDYWGOGTLVTV SS Click to Show/Hide
|
|||||
| Heavy Chain CDR 1 |
SSDYYYWS
Click to Show/Hide
|
|||||
| Heavy Chain CDR 2 |
YIYYSGSTNYNPSLKS
Click to Show/Hide
|
|||||
| Heavy Chain CDR 3 |
GDGDFLGVCFDY
Click to Show/Hide
|
|||||
| Light Chain Varible Domain |
EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIFDASNRATGIPA
RFSGSGSGTDFTLTISSLEPEDFAVYYCQQRSNWPLTFGGGTKVEIK Click to Show/Hide
|
|||||
| Light Chain CDR 1 |
RATLSCRASQSVSSYLA
Click to Show/Hide
|
|||||
| Light Chain CDR 2 |
DASNRAT
Click to Show/Hide
|
|||||
| Light Chain CDR 3 |
QQRSNWPLT
Click to Show/Hide
|
|||||
The Activity Data of This Antibody
| Antibody Activity Information 1 | [1] | |||||
|
Half Maximal Effective Concentration (EC50)
|
1.59
|
M
|
Caki-1 cells | CVCL_0234 | ||
|---|---|---|---|---|---|---|
| Antibody Function | 2E7 bound to Caki-1 cells | |||||
| Antibody Antigen Binding Assay | 3X10<sup>5</sup> cells were incubatedat 4°C for 30 min with 10 g/ml 2E7 antibody in FACS buffer (1X PBScontaining 0.1%% BSA). Cells were washed at 4°C to remove unbound material and kept on ice or shifted to 37°C for different lengths of time as needed. At progressive timepoints (Ohr, 0.shr, lhr, 2hr, 3hr, 4 hr)cells were stained with PE-conjugated anti-human Fc for 30 min at 4°C and analyzed by flow cytometry. Intemalization rate were calculated by subtracting the mean fluorescence intensity (MFl) of cell surface-bound antibody at 37'C at each time point from the MFI of cell surface-bound antibody at 4°C at time 0. | |||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
WO2024092067A1 ADC 2E7-LD038 (PA038) [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
36 nM
|
Moderate CD70 expression (CD70++) | ||
| Method Description |
Cell Raji were cultured in CO2, thermostatic incubator at 37°C with 5% CO2, in standard conditions. Cells were sub-cultured every 1-2 days, digested with 0.25% trypsin and passaged with a suitable density. When the cells were in the logarithmic growth phase and the amount meeting the assay's demand, cells were collectedand plated onto 96-well solid white flat bottom plates for assay. One day later test articles 2E7-LD038 conjugate ranging from 2 uM to 0.1nM, or extecan ranging from 20 uM to 0.03 nM were added to the cells. Plates were then incubated at 37°C for 96h. Cell Titer Glo (CTG) (40 ul per well) was subsequently added to the plates. Luciferase reading was collected 5min after and analyzed by Microplatereaders. All readings were normalized as percentage of viable cells in the untreated control wells and theICso yalues were calculated by Prism software.
Click to Show/Hide
|
||||
| In Vitro Model | EBV-related Burkitt lymphoma | Raji cells | CVCL_0511 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
37 nM
|
|||
| Method Description |
Cell Caki-1 were cultured in CO2, thermostatic incubator at 37°C with 5% CO2, in standard conditions. Cells were sub-cultured every 1-2 days, digested with 0.25% trypsin and passaged with a suitable density. When the cells were in the logarithmic growth phase and the amount meeting the assay's demand, cells were collectedand plated onto 96-well solid white flat bottom plates for assay. One day later test articles 2E7-LD038 conjugate ranging from 2 uM to 0.1nM, or extecan ranging from 20 uM to 0.03 nM were added to the cells. Plates were then incubated at 37°C for 96h. Cell Titer Glo (CTG) (40 ul per well) was subsequently added to the plates. Luciferase reading was collected 5min after and analyzed by Microplatereaders. All readings were normalized as percentage of viable cells in the untreated control wells and theICso yalues were calculated by Prism software.
Click to Show/Hide
|
||||
| In Vitro Model | Clear cell renal cell carcinoma | Caki-1 cells | CVCL_0234 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
292 nM
|
|||
| Method Description |
Cell 786-O were cultured in CO2, thermostatic incubator at 37°C with 5% CO2, in standard conditions. Cells were sub-cultured every 1-2 days, digested with 0.25% trypsin and passaged with a suitable density. When the cells were in the logarithmic growth phase and the amount meeting the assay's demand, cells were collectedand plated onto 96-well solid white flat bottom plates for assay. One day later test articles 2E7-LD038 conjugate ranging from 2 uM to 0.1nM, or extecan ranging from 20 uM to 0.03 nM were added to the cells. Plates were then incubated at 37°C for 96h. Cell Titer Glo (CTG) (40 ul per well) was subsequently added to the plates. Luciferase reading was collected 5min after and analyzed by Microplatereaders. All readings were normalized as percentage of viable cells in the untreated control wells and theICso yalues were calculated by Prism software.
Click to Show/Hide
|
||||
| In Vitro Model | Renal cell carcinoma | 786-O cells | CVCL_1051 | ||
