Antibody Information
General Information of This Antibody (ID: ANTI0QMUCF)
| Antibody Name | upifitamab |
|||||
|---|---|---|---|---|---|---|
| Antigen Name | NaPi-2b |
Antigen Info | ||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Sequence |
QVQLVQSGAEVVKPGASVKMSCKASGYTFTGYNIHWVKQAPGQGLEWIGAIYPGNGDTSY
KQKFRGRATLTADTSTSTVYMELSSLRSEDSAVYYCARGETARATFAYWGQGTLVTVSSG ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGG PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREE MTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW QQGNVFSCSVMHEALHNHYTQKSLSLSPG Click to Show/Hide
|
|||||
| Heavy Chain Varible Domain |
QVQLVQSGAEVVKPGASVKMSCKASGYTFTGYNIHWVKQAPGQGLEWIGAIYPGNGDTSY
KQKFRGRATLTADTSTSTVYMELSSLRSEDSAVYYCARGETARATFAYWGQGTLVTVSSG ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGG PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREE MTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW QQGNVFSCSVMHEALHNHYTQKSLSLSPG Click to Show/Hide
|
|||||
| Light Chain Sequence |
DIQMTQSPSSLSASVGDRVTITCSASQDIGNFLNWYQQKPGKTVKVLIYYTSSLYSGVPS
RFSGSGSGTDYTLTISSLQPEDFATYYCQQYSKLPLTFGQGTKLELKRRTVAAPSVFIFP PSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Click to Show/Hide
|
|||||
| Light Chain Varible Domain |
DIQMTQSPSSLSASVGDRVTITCSASQDIGNFLNWYQQKPGKTVKVLIYYTSSLYSGVPS
RFSGSGSGTDYTLTISSLQPEDFATYYCQQYSKLPLTFGQGTKLELKRRTVAAPSVFIFP PSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Click to Show/Hide
|
|||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
Upifitamab rilsodotin [Phase 3 (discontinued)]
Identified from the Human Clinical Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Objective Response Rate (ORR) |
15.60%
|
|||
| Patients Enrolled |
The QTc sub-study mandates compliance with UPLIFT criteria plus additional ECG monitoring, excluding patients with uncontrolled arrhythmias, severe valvular disease, or concomitant CYP3A inducers. Specific ovarian cancer exclusions for UPLIFT include non-high-grade histologies, primary platinum-refractory disease, and prior participation in DES/EXP cohorts.
Click to Show/Hide
|
||||
| Administration Dosage |
UPLIFT enrolled patients with up to 4 prior lines of therapy; patients were dosed at 36mg/m2 Q4W.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT03319628 | Clinical Status | PHASE1|||PHASE2 | ||
| Clinical Description |
A Phase 1b/2, First-in-Human, Dose Escalation and Expansion Study of XMT-1536 In Patients With Solid Tumors Likely to Express NaPi2b
|
||||
| Primary Endpoint |
The primary objectives include determining the maximum tolerated dose (MTD) or recommended Phase 2 dose of XMT-1536 (upifitamab rilsodotin) based on safety assessments. Secondary objectives evaluate safety, pharmacokinetics (PK), anti-drug antibodies, and anti-tumor efficacy including objective response rate (ORR) by investigator and independent review, duration of response (DOR), and QTc interval effects via concentration-QTc analysis.
Click to Show/Hide
|
||||
| Other Endpoint |
Key inclusion criteria for DES, EXP, and UPLIFT cohorts involve ECOG 0-1, measurable disease per RECIST v1.1, adequate organ function, and resolution of prior toxicities (≤Grade 1). UPLIFT specifically requires high-grade platinum-resistant ovarian cancer (1-4 prior lines, archival tumor for NaPi2b testing). Exclusion criteria include untreated CNS metastases, active infections (HIV/HBV/HCV), significant cardiac/liver/pulmonary dysfunction, recent major surgery/systemic therapy, or prior treatment with antitubulin ADCs.
Click to Show/Hide
|
||||
| Experiment 2 Reporting the Activity Date of This ADC | [2] | ||||
| Patients Enrolled |
Exclusion criteria include prior treatment with mirvetuximab soravtansine or related ADCs, recent bevacizumab use, symptomatic GI obstruction, ascites/pleural effusion requiring drainage within 28 days, significant liver disease, pneumonitis/interstitial lung disease, or untreated CNS metastases/leptomeningeal involvement. Participants with clinically significant conditions per investigator judgment are also excluded.
Click to Show/Hide
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT05329545 | Clinical Status | PHASE3 | ||
| Clinical Description |
A Phase 3, Randomized, Double-blind, Placebo-controlled, Multicenter Study of Upifitamab Rilsodotin (XMT-1536) as Post-Platinum Maintenance Therapy for Participants With Recurrent, Platinum-Sensitive, Ovarian Cancer (UP-NEXT)
|
||||
| Primary Endpoint |
The primary endpoint is progression-free survival (PFS) assessed by Blinded Independent Central Review (BICR) using RECIST v1.1, defined as time from randomization to disease progression or death. Secondary endpoints include overall survival (OS), PFS by investigator assessment, adverse events (AEs) per NCI CTCAE v5.0, ECOG performance status changes, objective response rate (ORR), and concomitant medication usage.
Click to Show/Hide
|
||||
| Other Endpoint |
Eligible participants must have histologically confirmed high-grade serous ovarian cancer (including fallopian tube/peritoneal) with platinum-sensitive recurrence, having received 4-8 cycles of prior platinum-based chemotherapy. Participants must provide tumor tissue for NaPi2b expression testing and meet specific BRCA mutation criteria if NED, CR, or PR was achieved without prior PARP inhibitor use.
Click to Show/Hide
|
||||
| Experiment 3 Reporting the Activity Date of This ADC | [3] | ||||
| Patients Enrolled |
General inclusion criteria require ECOG 0-1, measurable disease, resolved toxicities ≤Grade 1 (exceptions noted), LVEF ≥50%, adequate organ function (e.g., ANC ≥1500/mm3, platelets ≥100,000/mm3, GFR ≥45 mL/min), and no untreated CNS metastases. Key exclusions include recent major surgery, active infections (HIV/HBV/HCV), severe systemic disease, pneumonitis history, pregnancy, strong CYP3A modifiers use, or oxygen saturation <93%. Ovarian cancer-specific criteria mandate high-grade serous histology, platinum-resistant disease (1-4 prior lines, bevacizumab if 1-2 lines), and archival tumor availability. Exclusions cover low-grade/non-serous tumors, prior anti-tubulin ADCs, primary platinum resistance, and DES/EXP participation. The QTc sub-study requires adherence to UPLIFT criteria plus clinic stay for ECG assessments, excluding arrhythmias, severe valvular disease, or non-sinus rhythm (HR >45-<100).
Click to Show/Hide
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06517433 | Clinical Status | PHASE1 | ||
| Clinical Description |
A Phase 1b/2, First-in-Human, Dose Escalation and Expansion Study of XMT-1536 In Patients With Solid Tumors Likely to Express NaPi2b
|
||||
| Primary Endpoint |
The study evaluates the maximum tolerated dose or recommended Phase 2 dose of XMT-1536 (upifitamab rilsodotin) over 36 weeks, monitoring adverse events and concomitant medication use while assessing safety and tolerability from the first dose until 30 days post-study termination.
|
||||
| Other Endpoint |
The study evaluates the maximum tolerated dose or recommended Phase 2 dose of XMT-1536 (upifitamab rilsodotin) over 36 weeks, monitoring adverse events and concomitant medication use while assessing safety and tolerability from the first dose until 30 days post-study termination.
|
||||
| Experiment 4 Reporting the Activity Date of This ADC | [4] | ||||
| Patients Enrolled |
Key inclusion criteria require ECOG 0-1, measurable disease (RECIST v1.1), resolved prior toxicities (≤Grade 1, exceptions specified), LVEF ≥50%, adequate organ function (ANC ≥1500/mm <sup>3</sup>, platelets ≥100K/mm <sup>3</sup>, GFR ≥45 mL/min, bilirubin ≤ULN, AST/ALT ≤1.5x ULN, albumin ≥3.0 g/dL), and informed consent. Exclusion criteria include recent major surgery/anti-cancer therapy (<28 days or 5 half-lives), untreated CNS metastases, active HIV/HBV/HCV infections, severe systemic disease, oxygen therapy dependence, pneumonitis history, pregnancy, recent malignancy (exceptions allowed), active corneal disease, strong CYP3A modifiers, or O <sub>2</sub> saturation <93%. For ovarian cancer (UPLIFT), high-grade serous histology, platinum resistance (1-4 prior lines, bevacizumab if 1-2 lines), and tumor tissue availability are required; exclusions cover non-serous histologies, prior anti-tubulin ADCs, primary platinum resistance, and DES/EXP participation. The QTc sub-study mandates UPLIFT eligibility plus compliance with ECG monitoring (exclusions: strong CYP3A inducers, arrhythmias, severe valvular disease, HR >45-<100 bpm, non-sinus rhythm, or QT-interference ECG abnormalities).
Click to Show/Hide
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06517485 | Clinical Status | PHASE1 | ||
| Clinical Description |
A Phase 1b/2, First-in-Human, Dose Expansion Study of XMT-1536 In Patients With Solid Tumors Likely to Express NaPi2b
|
||||
| Primary Endpoint |
The study assesses safety and tolerability of the treatment, evaluating the incidence and severity of adverse events from the first dose until 30 days after study termination.
|
||||
| Experiment 5 Reporting the Activity Date of This ADC | [5] | ||||
| Patients Enrolled |
Safety monitoring will track adverse events per CTCAE v5.0, while pharmacokinetic analysis focuses on Cmax and AUC for both drugs. Antitumor activity assessments (ORR, DCR, PFS by RECIST 1.1, OS) occur every 8-12 weeks. Tumor NaPi2b expression and blood-based biomarkers will be analyzed for correlation with treatment response. The study excludes those with unresolved toxicity from prior therapies or contraindications to study drugs.
Click to Show/Hide
|
||||
| Administration Dosage |
XMT-1536 (Upifitamab Rilsodotin) will be administered on Day 1 of each 28-day cycle until disease progression, unacceptable toxicity, or either the patient or study physician determines it is in the best interest of the patient to discontinue participation in the study
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT04907968 | Clinical Status | PHASE1 | ||
| Clinical Description |
Upifitamab Rilsodotin (Xmt-1536) An Open-Label, Multicenter, Dose Escalation And Expansion Study Of Upifitamab Rilsodotin In Combination With Carboplatin In Participants With High Grade Serous Ovarian Cancer (Upgrade-A)
|
||||
| Primary Endpoint |
The study aims to determine the MTD of Upifitamab Rilsodotin with carboplatin by evaluating adverse events over 24 weeks, while assessing the feasibility of this combination therapy (defined as ≥60% of participants completing ≥4 cycles without discontinuation for reasons other than progression). Safety, tolerability (CTCAE v5.0), and pharmacokinetics (Cmax, AUC) of both drugs will be monitored. Antitumor effects will be evaluated via ORR, DOR, DCR, PFS (RECIST 1.1), and OS.
Click to Show/Hide
|
||||
| Other Endpoint |
Inclusion criteria require female participants ≥18 years with platinum-sensitive recurrent high-grade serous ovarian cancer (1-3 prior lines, measurable disease, ECOG 0-1). Tumor sampling is mandated, and organ function must be adequate (LVEF ≥50%, ANC ≥1500/mm 3, platelets ≥100K/mm 3). Key exclusions include carboplatin hypersensitivity requiring discontinuation, prior ADC treatment with auristatin/maytansinoid payloads, untreated CNS metastases, recent major surgery/anticancer therapy, concurrent malignancies, and blood transfusion refusal.
Click to Show/Hide
|
||||
| Experiment 6 Reporting the Activity Date of This ADC | [6] | ||||
| Efficacy Data | Objective Response Rate (ORR) |
34.00
35.00 29.00 % |
High SLC34A2 expression (SLC34A2+++; 66,000 SLC34A2 antigens/cell) | ||
| Patients Enrolled |
Ovarian cancer patients with 1-3 prior lines in platinum-resistant; 4 prior lines patients regardless of platinum status.
|
||||
| Administration Dosage |
36 or 43 mg/m 2 IV once every 4 weeks.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT03319628 | Clinical Status | Phase 1/2 | ||
| Clinical Description |
Open-label, dose escalation to reach mtd. the mtd will be confirmed in parallel cohorts: patients with platinum-resistant ovarian cancer; patients with non-squamous nsclc, adenocarcinoma subtype.
|
||||
| Experiment 7 Reporting the Activity Date of This ADC | [7] | ||||
| Related Clinical Trial | |||||
| NCT Number | NCT05329545 | Clinical Status | Phase 3 | ||
| Clinical Description |
A phase 3, randomized, double-blind, placebo-controlled, multicenter study of upifitamab rilsodotin (XMT-1536) as post-platinum maintenance therapy for participants with recurrent, platinum-sensitive, ovarian cancer (up-next).
|
||||
| Experiment 8 Reporting the Activity Date of This ADC | [8] | ||||
| Patients Enrolled |
Patients with a histological diagnosis of metastatic or recurrent high-grade serous ovarian cancer, including fallopian tube, or primary peritoneal cancer and have received 1-3 prior lines of therapy.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT04907968 | Clinical Status | Phase 1 | ||
| Clinical Description |
Upifitamab rilsodotin (XMT-1536) an open-label, multicenter, dose escalation and expansion study of upifitamab rilsodotin in combination with carboplatin in participants with high grade serous ovarian cancer (UP GRADE-A).
|
||||
Discovered Using Patient-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [9] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 58.60% | Moderate SLC34A2 expression (SLC34A2++) | ||
| Method Description |
Animals were randomized into treatment groups (n = 10) when the tumor target volume reached 100-150 mm3. Test articles were administered intravenously via tail vein injection. Mice received a single dose of either saline vehicle; XMT-1535 at 3 mg/kg; XMT-1536 (DAR 12.4) at 3 mg/kg; IgG1-Dolaflexin (DAR 18.1) at 3 mg/kg,or lifastuzumab vedotin (DAR 4.1) at 3 mg/kg. Tumors were measured twice per week. XMT-1536 and lifastuzumab vedotin were administered at a single dose of 3 mg/kg qwk x 3.
Click to Show/Hide
|
||||
| In Vivo Model | Lung cancer PDX model (PDX: CTG-0178) | ||||
| Experiment 2 Reporting the Activity Date of This ADC | [9] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 60.60% | Moderate SLC34A2 expression (SLC34A2++) | ||
| Method Description |
Animals were randomized into treatment groups (n = 10) when the tumor target volume reached 100-150 mm3. Test articles were administered intravenously via tail vein injection. Mice received a single dose of either saline vehicle; XMT-1535 at 3 mg/kg; XMT-1536 (DAR 12.4) at 3 mg/kg; IgG1-Dolaflexin (DAR 18.1) at 3 mg/kg,or lifastuzumab vedotin (DAR 4.1) at 3 mg/kg. Tumors were measured twice per week. XMT-1536 and lifastuzumab vedotin were administered at a single dose of 3 mg/kg qwk x 3.
Click to Show/Hide
|
||||
| In Vivo Model | Lung cancer PDX model (PDX: CTG-0178) | ||||
| Experiment 3 Reporting the Activity Date of This ADC | [9] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 87.40% | Moderate SLC34A2 expression (SLC34A2++) | ||
| Method Description |
Animals were randomized into treatment groups (n = 10) when the tumor target volume reached 100-150 mm3. Test articles were administered intravenously via tail vein injection. Mice received a single dose of either saline vehicle; XMT-1535 at 3 mg/kg; XMT-1536 (DAR 12.4) at 3 mg/kg; IgG1-Dolaflexin (DAR 18.1) at 3 mg/kg,or lifastuzumab vedotin (DAR 4.1) at 3 mg/kg. Tumors were measured twice per week. XMT-1536 and lifastuzumab vedotin were administered at a single dose of 3 mg/kg qwk x 3.
Click to Show/Hide
|
||||
| In Vivo Model | Non-small cell lung cancer PDX model (PDX: CTG-0860) | ||||
| Experiment 4 Reporting the Activity Date of This ADC | [9] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 94.10% | High SLC34A2 expression (SLC34A2+++) | ||
| Method Description |
Animals were randomized into treatment groups (n = 10) when the tumor target volume reached 100-150 mm3. Test articles were administered intravenously via tail vein injection. Mice received a single dose of either saline vehicle; XMT-1535 at 3 mg/kg; XMT-1536 (DAR 12.4) at 3 mg/kg; IgG1-Dolaflexin (DAR 18.1) at 3 mg/kg,or lifastuzumab vedotin (DAR 4.1) at 3 mg/kg. Tumors were measured twice per week. XMT-1536 and lifastuzumab vedotin were administered at a single dose of 3 mg/kg qwk x 3.
Click to Show/Hide
|
||||
| In Vivo Model | Lung cancer PDX model (PDX: CTG-0852) | ||||
| Experiment 5 Reporting the Activity Date of This ADC | [9] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 95.40% | High SLC34A2 expression (SLC34A2+++) | ||
| Method Description |
Animals were randomized into treatment groups (n = 10) when the tumor target volume reached 100-150 mm3. Test articles were administered intravenously via tail vein injection. Mice received a single dose of either saline vehicle; XMT-1535 at 3 mg/kg; XMT-1536 (DAR 12.4) at 3 mg/kg; IgG1-Dolaflexin (DAR 18.1) at 3 mg/kg,or lifastuzumab vedotin (DAR 4.1) at 3 mg/kg. Tumors were measured twice per week. XMT-1536 and lifastuzumab vedotin were administered at a single dose of 3 mg/kg qwk x 3.
Click to Show/Hide
|
||||
| In Vivo Model | Lung cancer PDX model (PDX: CTG-0852) | ||||
| Experiment 6 Reporting the Activity Date of This ADC | [9] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 96.70% | High SLC34A2 expression (SLC34A2+++) | ||
| Method Description |
Animals were randomized into treatment groups (n = 10) when the tumor target volume reached 100-150 mm3. Test articles were administered intravenously via tail vein injection. Mice received a single dose of either saline vehicle; XMT-1535 at 3 mg/kg; XMT-1536 (DAR 12.4) at 3 mg/kg; IgG1-Dolaflexin (DAR 18.1) at 3 mg/kg,or lifastuzumab vedotin (DAR 4.1) at 3 mg/kg. Tumors were measured twice per week. XMT-1536 and lifastuzumab vedotin were administered at a single dose of 3 mg/kg qwk x 3.
Click to Show/Hide
|
||||
| In Vivo Model | Lung cancer PDX model (PDX: CTG-0852) | ||||
Discovered Using Cell Line-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [9] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 94% | High SLC34A2 expression (SLC34A2+++) | ||
| Method Description |
Animals were randomized into treatment groups (n = 10) when the tumor target volume reached 100-150 mm3. Test articles were administered intravenously via tail vein injection. Mice received a single dose of either saline vehicle; XMT-1535 at 3 mg/kg; XMT-1536 (DAR 12.4) at 3 mg/kg; IgG1-Dolaflexin (DAR 18.1) at 3 mg/kg,or lifastuzumab vedotin (DAR 4.1) at 3 mg/kg. Tumors were measured twice per week. XMT-1536 and lifastuzumab vedotin were administered at a single dose of 3 mg/kg.
Click to Show/Hide
|
||||
| In Vivo Model | Ovarian adenocarcinoma CDX model | ||||
| In Vitro Model | Ovarian serous adenocarcinoma | OVCAR-3 cells | CVCL_0465 | ||
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [9] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
0.52 nM
|
|||
| Method Description |
OVCAR3 cells were grown in RPMI1640 media supplemented with 20% FBS and 1% penicillin/streptomycin,seeded at a density of 5, 000 cells per well in 100 L of growth media in a 96-well,white flat-bottom plate. Following overnight incubation,the media was replaced with 100 L of fresh media containing the test compounds at a 3-fold titration up to 33 nmol/L. The treated cells were incubated for 96 hours at 37°C in the presence of 5% CO2. In the OVCAR3 cell line,XMT-1536 was cytotoxic in a 96-hour cellular cytotoxicity assay.
Click to Show/Hide
|
||||
| In Vitro Model | Ovarian serous adenocarcinoma | OVCAR-3 cells | CVCL_0465 | ||
References
