General Information of This Antibody
Antibody ID
ANTI0MZYVB
Antibody Name
1C1
Synonyms
1C1
   Click to Show/Hide
Antibody Type
Monoclonal antibody (mAb)
Antibody Subtype
Humanized lgG1-kappa
Antigen Name
Ephrin type-A receptor 2 (EPHA2)
 Antigen Info 
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence
EVQLLESGGGLVQPGGSLRLSCAASGFTFSHYMMAWVRQAPGKGLEWVSRIGPSGGPTHY
ADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAGYDSGYDYVAVAGPAEYFQHWGQ
GTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPCPVTVSWNSGALTSGVHT
FPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPC
PAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKT
KPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVY
TLPPSREEMTKNQVSLTCLVKGFYPCDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSK
LTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    Click to Show/Hide
Light Chain Sequence
DIOMTOSPSSLSASVGDRVTITCRASOSISTWLAWYOOKPGKAPKLLIYKASNLHTGVPS
RFSGSGSGTEFSLTISGLOPDDFATYYCOOYNSYSRTFGOGTKVEIKRTVAAPSVFIFPP
SDEOLKSGTASVVCLLNNFYPREAKVOWKVDNALOSGNSOESVTEODSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHOGLSSPVTKSFNRGEC
    Click to Show/Hide
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
CN119343152A 1C1-Example 3 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 3 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
0.075 nM
High EPH2 expression (EPH2 +++)
Method Description
Cultivate the cell line in a tissue culture incubator at 5% CO2 and 37 °C in the optimal growth medium. Separate cells at least 2 days prior to inoculation for proliferation assays to ensure optimal growth density. On the day of vaccination, cell viability and cell density were determined using a cell counter (Vi Cell XR Cell viability analyzer, Beckman Coulter). Inoculate cells with vitality above 85% into a 384 well TC treated plate (Corning catalog number 3765) with a white transparent bottom. Inoculate cells at a density of 1000 cells per well into 45 u L of standard growth medium. Incubate the plate overnight in a tissue culture incubator at 5% CO2 and 37 °C. On the second day, prepare free atorvastatin payload and targeted ADC at a 10 fold ratio in standard growth medium. Add the prepared treatment substance to the cells to obtain a final concentration of 0.005-100nM and a final volume of 50 u L/well. Each drug concentration is tested in quadruplicate. Incubate the plates in a tissue culture incubator at 5% CO2 and 37 °C for 5 days, and then evaluate cell viability by adding 25 u L of CellTiterGlo (Promega, catalog number G7573) (a reagent for cell lysis and measurement of total adenosine triphosphate (ATP) content). Incubate the plate at room temperature for 10 minutes to stabilize the luminescence signal, and then read using a luminescence reader (EnVision multi label enzyme-linked immunosorbent assay, PerkinElmer). To evaluate the effectiveness of drug treatment, luminescence counts from wells containing untreated cells (100% viability) were used to normalize the treated samples. Apply a variable slope model to fit the nonlinear regression curve to the data in GraphPad PRISM version 7.02 software. Extrapolating IC50 from the obtained curve

   Click to Show/Hide
In Vitro Model Lung squamous cell carcinoma EBC1 cells CVCL_2891
Experiment 2 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
0.111 nM
High EPH2 expression (EPH2 +++)
Method Description
Cultivate the cell line in a tissue culture incubator at 5% CO2 and 37 °C in the optimal growth medium. Separate cells at least 2 days prior to inoculation for proliferation assays to ensure optimal growth density. On the day of vaccination, cell viability and cell density were determined using a cell counter (Vi Cell XR Cell viability analyzer, Beckman Coulter). Inoculate cells with vitality above 85% into a 384 well TC treated plate (Corning catalog number 3765) with a white transparent bottom. Inoculate cells at a density of 1000 cells per well into 45 u L of standard growth medium. Incubate the plate overnight in a tissue culture incubator at 5% CO2 and 37 °C. On the second day, prepare free atorvastatin payload and targeted ADC at a 10 fold ratio in standard growth medium. Add the prepared treatment substance to the cells to obtain a final concentration of 0.005-100nM and a final volume of 50 u L/well. Each drug concentration is tested in quadruplicate. Incubate the plates in a tissue culture incubator at 5% CO2 and 37 °C for 5 days, and then evaluate cell viability by adding 25 u L of CellTiterGlo (Promega, catalog number G7573) (a reagent for cell lysis and measurement of total adenosine triphosphate (ATP) content). Incubate the plate at room temperature for 10 minutes to stabilize the luminescence signal, and then read using a luminescence reader (EnVision multi label enzyme-linked immunosorbent assay, PerkinElmer). To evaluate the effectiveness of drug treatment, luminescence counts from wells containing untreated cells (100% viability) were used to normalize the treated samples. Apply a variable slope model to fit the nonlinear regression curve to the data in GraphPad PRISM version 7.02 software. Extrapolating IC50 from the obtained curve

   Click to Show/Hide
In Vitro Model Colon adenocarcinoma SKCO1 cells CVCL_0626
Experiment 3 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
1.39 nM
High EPH2 expression (EPH2 +++)
Method Description
Cultivate the cell line in a tissue culture incubator at 5% CO2 and 37 °C in the optimal growth medium. Separate cells at least 2 days prior to inoculation for proliferation assays to ensure optimal growth density. On the day of vaccination, cell viability and cell density were determined using a cell counter (Vi Cell XR Cell viability analyzer, Beckman Coulter). Inoculate cells with vitality above 85% into a 384 well TC treated plate (Corning catalog number 3765) with a white transparent bottom. Inoculate cells at a density of 1000 cells per well into 45 u L of standard growth medium. Incubate the plate overnight in a tissue culture incubator at 5% CO2 and 37 °C. On the second day, prepare free atorvastatin payload and targeted ADC at a 10 fold ratio in standard growth medium. Add the prepared treatment substance to the cells to obtain a final concentration of 0.005-100nM and a final volume of 50 u L/well. Each drug concentration is tested in quadruplicate. Incubate the plates in a tissue culture incubator at 5% CO2 and 37 °C for 5 days, and then evaluate cell viability by adding 25 u L of CellTiterGlo (Promega, catalog number G7573) (a reagent for cell lysis and measurement of total adenosine triphosphate (ATP) content). Incubate the plate at room temperature for 10 minutes to stabilize the luminescence signal, and then read using a luminescence reader (EnVision multi label enzyme-linked immunosorbent assay, PerkinElmer). To evaluate the effectiveness of drug treatment, luminescence counts from wells containing untreated cells (100% viability) were used to normalize the treated samples. Apply a variable slope model to fit the nonlinear regression curve to the data in GraphPad PRISM version 7.02 software. Extrapolating IC50 from the obtained curve

   Click to Show/Hide
In Vitro Model Gastric signet ring cell adenocarcinoma OCUM1 cells CVCL_3084
CN119343152A 1C1-Example 4 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 3 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
0.146 nM
High EPH2 expression (EPH2 +++)
Method Description
Cultivate the cell line in a tissue culture incubator at 5% CO2 and 37 °C in the optimal growth medium. Separate cells at least 2 days prior to inoculation for proliferation assays to ensure optimal growth density. On the day of vaccination, cell viability and cell density were determined using a cell counter (Vi Cell XR Cell viability analyzer, Beckman Coulter). Inoculate cells with vitality above 85% into a 384 well TC treated plate (Corning catalog number 3765) with a white transparent bottom. Inoculate cells at a density of 1000 cells per well into 45 u L of standard growth medium. Incubate the plate overnight in a tissue culture incubator at 5% CO2 and 37 °C. On the second day, prepare free atorvastatin payload and targeted ADC at a 10 fold ratio in standard growth medium. Add the prepared treatment substance to the cells to obtain a final concentration of 0.005-100nM and a final volume of 50 u L/well. Each drug concentration is tested in quadruplicate. Incubate the plates in a tissue culture incubator at 5% CO2 and 37 °C for 5 days, and then evaluate cell viability by adding 25 u L of CellTiterGlo (Promega, catalog number G7573) (a reagent for cell lysis and measurement of total adenosine triphosphate (ATP) content). Incubate the plate at room temperature for 10 minutes to stabilize the luminescence signal, and then read using a luminescence reader (EnVision multi label enzyme-linked immunosorbent assay, PerkinElmer). To evaluate the effectiveness of drug treatment, luminescence counts from wells containing untreated cells (100% viability) were used to normalize the treated samples. Apply a variable slope model to fit the nonlinear regression curve to the data in GraphPad PRISM version 7.02 software. Extrapolating IC50 from the obtained curve

   Click to Show/Hide
In Vitro Model Lung squamous cell carcinoma EBC1 cells CVCL_2891
Experiment 2 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
0.166 nM
High EPH2 expression (EPH2 +++)
Method Description
Cultivate the cell line in a tissue culture incubator at 5% CO2 and 37 °C in the optimal growth medium. Separate cells at least 2 days prior to inoculation for proliferation assays to ensure optimal growth density. On the day of vaccination, cell viability and cell density were determined using a cell counter (Vi Cell XR Cell viability analyzer, Beckman Coulter). Inoculate cells with vitality above 85% into a 384 well TC treated plate (Corning catalog number 3765) with a white transparent bottom. Inoculate cells at a density of 1000 cells per well into 45 u L of standard growth medium. Incubate the plate overnight in a tissue culture incubator at 5% CO2 and 37 °C. On the second day, prepare free atorvastatin payload and targeted ADC at a 10 fold ratio in standard growth medium. Add the prepared treatment substance to the cells to obtain a final concentration of 0.005-100nM and a final volume of 50 u L/well. Each drug concentration is tested in quadruplicate. Incubate the plates in a tissue culture incubator at 5% CO2 and 37 °C for 5 days, and then evaluate cell viability by adding 25 u L of CellTiterGlo (Promega, catalog number G7573) (a reagent for cell lysis and measurement of total adenosine triphosphate (ATP) content). Incubate the plate at room temperature for 10 minutes to stabilize the luminescence signal, and then read using a luminescence reader (EnVision multi label enzyme-linked immunosorbent assay, PerkinElmer). To evaluate the effectiveness of drug treatment, luminescence counts from wells containing untreated cells (100% viability) were used to normalize the treated samples. Apply a variable slope model to fit the nonlinear regression curve to the data in GraphPad PRISM version 7.02 software. Extrapolating IC50 from the obtained curve

   Click to Show/Hide
In Vitro Model Colon adenocarcinoma SKCO1 cells CVCL_0626
Experiment 3 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
1.73 nM
High EPH2 expression (EPH2 +++)
Method Description
Cultivate the cell line in a tissue culture incubator at 5% CO2 and 37 °C in the optimal growth medium. Separate cells at least 2 days prior to inoculation for proliferation assays to ensure optimal growth density. On the day of vaccination, cell viability and cell density were determined using a cell counter (Vi Cell XR Cell viability analyzer, Beckman Coulter). Inoculate cells with vitality above 85% into a 384 well TC treated plate (Corning catalog number 3765) with a white transparent bottom. Inoculate cells at a density of 1000 cells per well into 45 u L of standard growth medium. Incubate the plate overnight in a tissue culture incubator at 5% CO2 and 37 °C. On the second day, prepare free atorvastatin payload and targeted ADC at a 10 fold ratio in standard growth medium. Add the prepared treatment substance to the cells to obtain a final concentration of 0.005-100nM and a final volume of 50 u L/well. Each drug concentration is tested in quadruplicate. Incubate the plates in a tissue culture incubator at 5% CO2 and 37 °C for 5 days, and then evaluate cell viability by adding 25 u L of CellTiterGlo (Promega, catalog number G7573) (a reagent for cell lysis and measurement of total adenosine triphosphate (ATP) content). Incubate the plate at room temperature for 10 minutes to stabilize the luminescence signal, and then read using a luminescence reader (EnVision multi label enzyme-linked immunosorbent assay, PerkinElmer). To evaluate the effectiveness of drug treatment, luminescence counts from wells containing untreated cells (100% viability) were used to normalize the treated samples. Apply a variable slope model to fit the nonlinear regression curve to the data in GraphPad PRISM version 7.02 software. Extrapolating IC50 from the obtained curve

   Click to Show/Hide
In Vitro Model Gastric signet ring cell adenocarcinoma OCUM1 cells CVCL_3084
CN119343152A 1C1-Example 2 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 3 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
0.299 nM
High EPH2 expression (EPH2 +++)
Method Description
Cultivate the cell line in a tissue culture incubator at 5% CO2 and 37 °C in the optimal growth medium. Separate cells at least 2 days prior to inoculation for proliferation assays to ensure optimal growth density. On the day of vaccination, cell viability and cell density were determined using a cell counter (Vi Cell XR Cell viability analyzer, Beckman Coulter). Inoculate cells with vitality above 85% into a 384 well TC treated plate (Corning catalog number 3765) with a white transparent bottom. Inoculate cells at a density of 1000 cells per well into 45 u L of standard growth medium. Incubate the plate overnight in a tissue culture incubator at 5% CO2 and 37 °C. On the second day, prepare free atorvastatin payload and targeted ADC at a 10 fold ratio in standard growth medium. Add the prepared treatment substance to the cells to obtain a final concentration of 0.005-100nM and a final volume of 50 u L/well. Each drug concentration is tested in quadruplicate. Incubate the plates in a tissue culture incubator at 5% CO2 and 37 °C for 5 days, and then evaluate cell viability by adding 25 u L of CellTiterGlo (Promega, catalog number G7573) (a reagent for cell lysis and measurement of total adenosine triphosphate (ATP) content). Incubate the plate at room temperature for 10 minutes to stabilize the luminescence signal, and then read using a luminescence reader (EnVision multi label enzyme-linked immunosorbent assay, PerkinElmer). To evaluate the effectiveness of drug treatment, luminescence counts from wells containing untreated cells (100% viability) were used to normalize the treated samples. Apply a variable slope model to fit the nonlinear regression curve to the data in GraphPad PRISM version 7.02 software. Extrapolating IC50 from the obtained curve

   Click to Show/Hide
In Vitro Model Lung squamous cell carcinoma EBC1 cells CVCL_2891
Experiment 2 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
1.84 nM
High EPH2 expression (EPH2 +++)
Method Description
Cultivate the cell line in a tissue culture incubator at 5% CO2 and 37 °C in the optimal growth medium. Separate cells at least 2 days prior to inoculation for proliferation assays to ensure optimal growth density. On the day of vaccination, cell viability and cell density were determined using a cell counter (Vi Cell XR Cell viability analyzer, Beckman Coulter). Inoculate cells with vitality above 85% into a 384 well TC treated plate (Corning catalog number 3765) with a white transparent bottom. Inoculate cells at a density of 1000 cells per well into 45 u L of standard growth medium. Incubate the plate overnight in a tissue culture incubator at 5% CO2 and 37 °C. On the second day, prepare free atorvastatin payload and targeted ADC at a 10 fold ratio in standard growth medium. Add the prepared treatment substance to the cells to obtain a final concentration of 0.005-100nM and a final volume of 50 u L/well. Each drug concentration is tested in quadruplicate. Incubate the plates in a tissue culture incubator at 5% CO2 and 37 °C for 5 days, and then evaluate cell viability by adding 25 u L of CellTiterGlo (Promega, catalog number G7573) (a reagent for cell lysis and measurement of total adenosine triphosphate (ATP) content). Incubate the plate at room temperature for 10 minutes to stabilize the luminescence signal, and then read using a luminescence reader (EnVision multi label enzyme-linked immunosorbent assay, PerkinElmer). To evaluate the effectiveness of drug treatment, luminescence counts from wells containing untreated cells (100% viability) were used to normalize the treated samples. Apply a variable slope model to fit the nonlinear regression curve to the data in GraphPad PRISM version 7.02 software. Extrapolating IC50 from the obtained curve

   Click to Show/Hide
In Vitro Model Colon adenocarcinoma SKCO1 cells CVCL_0626
Experiment 3 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
6.43 nM
High EPH2 expression (EPH2 +++)
Method Description
Cultivate the cell line in a tissue culture incubator at 5% CO2 and 37 °C in the optimal growth medium. Separate cells at least 2 days prior to inoculation for proliferation assays to ensure optimal growth density. On the day of vaccination, cell viability and cell density were determined using a cell counter (Vi Cell XR Cell viability analyzer, Beckman Coulter). Inoculate cells with vitality above 85% into a 384 well TC treated plate (Corning catalog number 3765) with a white transparent bottom. Inoculate cells at a density of 1000 cells per well into 45 u L of standard growth medium. Incubate the plate overnight in a tissue culture incubator at 5% CO2 and 37 °C. On the second day, prepare free atorvastatin payload and targeted ADC at a 10 fold ratio in standard growth medium. Add the prepared treatment substance to the cells to obtain a final concentration of 0.005-100nM and a final volume of 50 u L/well. Each drug concentration is tested in quadruplicate. Incubate the plates in a tissue culture incubator at 5% CO2 and 37 °C for 5 days, and then evaluate cell viability by adding 25 u L of CellTiterGlo (Promega, catalog number G7573) (a reagent for cell lysis and measurement of total adenosine triphosphate (ATP) content). Incubate the plate at room temperature for 10 minutes to stabilize the luminescence signal, and then read using a luminescence reader (EnVision multi label enzyme-linked immunosorbent assay, PerkinElmer). To evaluate the effectiveness of drug treatment, luminescence counts from wells containing untreated cells (100% viability) were used to normalize the treated samples. Apply a variable slope model to fit the nonlinear regression curve to the data in GraphPad PRISM version 7.02 software. Extrapolating IC50 from the obtained curve

   Click to Show/Hide
In Vitro Model Gastric signet ring cell adenocarcinoma OCUM1 cells CVCL_3084
CN119343152A 1C1-Example 1 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 3 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
0.409 nM
High EPH2 expression (EPH2 +++)
Method Description
Cultivate the cell line in a tissue culture incubator at 5% CO2 and 37 °C in the optimal growth medium. Separate cells at least 2 days prior to inoculation for proliferation assays to ensure optimal growth density. On the day of vaccination, cell viability and cell density were determined using a cell counter (Vi Cell XR Cell viability analyzer, Beckman Coulter). Inoculate cells with vitality above 85% into a 384 well TC treated plate (Corning catalog number 3765) with a white transparent bottom. Inoculate cells at a density of 1000 cells per well into 45 u L of standard growth medium. Incubate the plate overnight in a tissue culture incubator at 5% CO2 and 37 °C. On the second day, prepare free atorvastatin payload and targeted ADC at a 10 fold ratio in standard growth medium. Add the prepared treatment substance to the cells to obtain a final concentration of 0.005-100nM and a final volume of 50 u L/well. Each drug concentration is tested in quadruplicate. Incubate the plates in a tissue culture incubator at 5% CO2 and 37 °C for 5 days, and then evaluate cell viability by adding 25 u L of CellTiterGlo (Promega, catalog number G7573) (a reagent for cell lysis and measurement of total adenosine triphosphate (ATP) content). Incubate the plate at room temperature for 10 minutes to stabilize the luminescence signal, and then read using a luminescence reader (EnVision multi label enzyme-linked immunosorbent assay, PerkinElmer). To evaluate the effectiveness of drug treatment, luminescence counts from wells containing untreated cells (100% viability) were used to normalize the treated samples. Apply a variable slope model to fit the nonlinear regression curve to the data in GraphPad PRISM version 7.02 software. Extrapolating IC50 from the obtained curve

   Click to Show/Hide
In Vitro Model Lung squamous cell carcinoma EBC1 cells CVCL_2891
Experiment 2 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
10.66 nM
High EPH2 expression (EPH2 +++)
Method Description
Cultivate the cell line in a tissue culture incubator at 5% CO2 and 37 °C in the optimal growth medium. Separate cells at least 2 days prior to inoculation for proliferation assays to ensure optimal growth density. On the day of vaccination, cell viability and cell density were determined using a cell counter (Vi Cell XR Cell viability analyzer, Beckman Coulter). Inoculate cells with vitality above 85% into a 384 well TC treated plate (Corning catalog number 3765) with a white transparent bottom. Inoculate cells at a density of 1000 cells per well into 45 u L of standard growth medium. Incubate the plate overnight in a tissue culture incubator at 5% CO2 and 37 °C. On the second day, prepare free atorvastatin payload and targeted ADC at a 10 fold ratio in standard growth medium. Add the prepared treatment substance to the cells to obtain a final concentration of 0.005-100nM and a final volume of 50 u L/well. Each drug concentration is tested in quadruplicate. Incubate the plates in a tissue culture incubator at 5% CO2 and 37 °C for 5 days, and then evaluate cell viability by adding 25 u L of CellTiterGlo (Promega, catalog number G7573) (a reagent for cell lysis and measurement of total adenosine triphosphate (ATP) content). Incubate the plate at room temperature for 10 minutes to stabilize the luminescence signal, and then read using a luminescence reader (EnVision multi label enzyme-linked immunosorbent assay, PerkinElmer). To evaluate the effectiveness of drug treatment, luminescence counts from wells containing untreated cells (100% viability) were used to normalize the treated samples. Apply a variable slope model to fit the nonlinear regression curve to the data in GraphPad PRISM version 7.02 software. Extrapolating IC50 from the obtained curve

   Click to Show/Hide
In Vitro Model Colon adenocarcinoma SKCO1 cells CVCL_0626
Experiment 3 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
12.02 nM
High EPH2 expression (EPH2 +++)
Method Description
Cultivate the cell line in a tissue culture incubator at 5% CO2 and 37 °C in the optimal growth medium. Separate cells at least 2 days prior to inoculation for proliferation assays to ensure optimal growth density. On the day of vaccination, cell viability and cell density were determined using a cell counter (Vi Cell XR Cell viability analyzer, Beckman Coulter). Inoculate cells with vitality above 85% into a 384 well TC treated plate (Corning catalog number 3765) with a white transparent bottom. Inoculate cells at a density of 1000 cells per well into 45 u L of standard growth medium. Incubate the plate overnight in a tissue culture incubator at 5% CO2 and 37 °C. On the second day, prepare free atorvastatin payload and targeted ADC at a 10 fold ratio in standard growth medium. Add the prepared treatment substance to the cells to obtain a final concentration of 0.005-100nM and a final volume of 50 u L/well. Each drug concentration is tested in quadruplicate. Incubate the plates in a tissue culture incubator at 5% CO2 and 37 °C for 5 days, and then evaluate cell viability by adding 25 u L of CellTiterGlo (Promega, catalog number G7573) (a reagent for cell lysis and measurement of total adenosine triphosphate (ATP) content). Incubate the plate at room temperature for 10 minutes to stabilize the luminescence signal, and then read using a luminescence reader (EnVision multi label enzyme-linked immunosorbent assay, PerkinElmer). To evaluate the effectiveness of drug treatment, luminescence counts from wells containing untreated cells (100% viability) were used to normalize the treated samples. Apply a variable slope model to fit the nonlinear regression curve to the data in GraphPad PRISM version 7.02 software. Extrapolating IC50 from the obtained curve

   Click to Show/Hide
In Vitro Model Gastric signet ring cell adenocarcinoma OCUM1 cells CVCL_3084
References
Ref 1 Antibody-drug conjugates