Antigen ID	TAR0GFSKS
Antigen Name	Ephrin type-A receptor 2 (EPHA2)
Gene Name	EPHA2
Gene ID	1969
Synonym	ECK; Epithelial cell kinase;Tyrosine-protein kinase receptor ECK
Sequence	MELQAARACFALLWGCALAAAAAAQGKEVVLLDFAAAGGELGWLTHPYGKGWDLMQNIMN DMPIYMYSVCNVMSGDQDNWLRTNWVYRGEAERIFIELKFTVRDCNSFPGGASSCKETFN LYYAESDLDYGTNFQKRLFTKIDTIAPDEITVSSDFEARHVKLNVEERSVGPLTRKGFYL AFQDIGACVALLSVRVYYKKCPELLQGLAHFPETIAGSDAPSLATVAGTCVDHAVVPPGG EEPRMHCAVDGEWLVPIGQCLCQAGYEKVEDACQACSPGFFKFEASESPCLECPEHTLPS PEGATSCECEEGFFRAPQDPASMPCTRPPSAPHYLTAVGMGAKVELRWTPPQDSGGREDI VYSVTCEQCWPESGECGPCEASVRYSEPPHGLTRTSVTVSDLEPHMNYTFTVEARNGVSG LVTSRSFRTASVSINQTEPPKVRLEGRSTTSLSVSWSIPPPQQSRVWKYEVTYRKKGDSN SYNVRRTEGFSVTLDDLAPDTTYLVQVQALTQEGQGAGSKVHEFQTLSPEGSGNLAVIGG VAVGVVLLLVLAGVGFFIHRRRKNQRARQSPEDVYFSKSEQLKPLKTYVDPHTYEDPNQA VLKFTTEIHPSCVTRQKVIGAGEFGEVYKGMLKTSSGKKEVPVAIKTLKAGYTEKQRVDF LGEAGIMGQFSHHNIIRLEGVISKYKPMMIITEYMENGALDKFLREKDGEFSVLQLVGML RGIAAGMKYLANMNYVHRDLAARNILVNSNLVCKVSDFGLSRVLEDDPEATYTTSGGKIP IRWTAPEAISYRKFTSASDVWSFGIVMWEVMTYGERPYWELSNHEVMKAINDGFRLPTPM DCPSAIYQLMMQCWQQERARRPKFADIVSILDKLIRAPDSLKTLADFDPRVSIRLPSTSG SEGVPFRTVSEWLESIKMQQYTEHFMAAGYTAIEKVVQMTNDDIKRIGVRLPGHQKRIAY SLLGLKDQVNTVGIPI     Click to Show/Hide
Family	Tyr protein family
Function	Receptor tyrosine kinase which binds promiscuously membrane- bound ephrin-A family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Activated by the ligand ephrin- A1/EFNA1 regulates migration, integrin-mediated adhesion, proliferation and differentiation of cells. Regulates cell adhesion and differentiation through DSG1/desmoglein-1 and inhibition of the ERK1/ERK2 (MAPK3/MAPK1, respectively) signaling pathway. May also participate in UV radiation-induced apoptosis and have a ligand- independent stimulatory effect on chemotactic cell migration. During development, may function in distinctive aspects of pattern formation and subsequently in development of several fetal tissues. Involved for instance in angiogenesis, in early hindbrain development and epithelial proliferation and branching morphogenesis during mammary gland development. Engaged by the ligand ephrin-A5/EFNA5 may regulate lens fiber cells shape and interactions and be important for lens transparency development and maintenance. With ephrin-A2/EFNA2 may play a role in bone remodeling through regulation of osteoclastogenesis and osteoblastogenesis.     Click to Show/Hide
Uniprot Entry	EPHA2_HUMAN
HGNC ID	HGNC:3386
KEGG ID	hsa:1969

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	EphA2-targeted mAb ADC 144	EphA2-targeted mAb ADC 144 payload	Undisclosed	EphA2-targeted mAb ADC 144 linker	[1]
ADC Info	EphA2-targeted mAb ADC 145	EphA2-targeted mAb ADC 145 payload	Undisclosed	EphA2-targeted mAb ADC 145 linker	[1]
ADC Info	EphA2-targeted mAb ADC 146	EphA2-targeted mAb ADC 146 payload	Undisclosed	EphA2-targeted mAb ADC 146 linker	[1]
ADC Info	EphA2-targeted mAb ADC 147	EphA2-targeted mAb ADC 147 payload	Undisclosed	EphA2-targeted mAb ADC 147 linker	[1]
ADC Info	EphA2-targeted mAb ADC 148	EphA2-targeted mAb ADC 148 payload	Undisclosed	EphA2-targeted mAb ADC 148 linker	[1]
ADC Info	EphA2-targeted mAb ADC 149	EphA2-targeted mAb ADC 149 payload	Undisclosed	EphA2-targeted mAb ADC 149 linker	[1]
ADC Info	EphA2-targeted mAb ADC 150	EphA2-targeted mAb ADC 150 payload	Undisclosed	EphA2-targeted mAb ADC 150 linker	[1]
ADC Info	EphA2-targeted mAb ADC 151	EphA2-targeted mAb ADC 151 payload	Undisclosed	EphA2-targeted mAb ADC 151 linker	[1]
ADC Info	EphA2-targeted mAb ADC 152	EphA2-targeted mAb ADC 152 payload	Undisclosed	EphA2-targeted mAb ADC 152 linker	[1]
ADC Info	EphA2-targeted mAb ADC A 12 (DAR8)	EphA2-targeted mAb ADC A 12 (DAR8) payload	Undisclosed	EphA2-targeted mAb ADC A 12 (DAR8) linker	[1]
ADC Info	EphA2-targeted mAb ADC A 12 (DAR4)	EphA2-targeted mAb ADC A 12 (DAR4) payload	Undisclosed	EphA2-targeted mAb ADC A 12 (DAR4) linker	[1]
ADC Info	EphA2-targeted mAb ADC A 17 (DAR8)	EphA2-targeted mAb ADC A 17 (DAR8) payload	Undisclosed	EphA2-targeted mAb ADC A 17 (DAR8) linker	[1]
ADC Info	EphA2-targeted mAb ADC A 17 (DAR4)	EphA2-targeted mAb ADC A 17 (DAR4) payload	Undisclosed	EphA2-targeted mAb ADC A 17 (DAR4) linker	[1]
ADC Info	EphA2-targeted mAb ADC A 21 (DAR8)	EphA2-targeted mAb ADC A 21 (DAR8) payload	Undisclosed	EphA2-targeted mAb ADC A 21 (DAR8) linker	[1]
ADC Info	EphA2-targeted mAb ADC A 21 (DAR4)	EphA2-targeted mAb ADC A 21 (DAR4) payload	Undisclosed	EphA2-targeted mAb ADC A 21 (DAR4) linker	[1]
ADC Info	EphA2-targeted mAb ADC A 22 (DAR6)	EphA2-targeted mAb ADC A 22 (DAR6) payload	Undisclosed	EphA2-targeted mAb ADC A 22 (DAR6) linker	[1]
ADC Info	EphA2-targeted mAb ADC A 22 (DAR2)	EphA2-targeted mAb ADC A 22 (DAR2) payload	Undisclosed	EphA2-targeted mAb ADC A 22 (DAR2) linker	[1]
ADC Info	EphA2-targeted mAb ADC A 19 (DAR8)	EphA2-targeted mAb ADC A 19 (DAR8) payload	Undisclosed	EphA2-targeted mAb ADC A 19 (DAR8) linker	[1]
ADC Info	EphA2-targeted mAb ADC A 19 (DAR4)	EphA2-targeted mAb ADC A 19 (DAR4) payload	Undisclosed	EphA2-targeted mAb ADC A 19 (DAR4) linker	[1]
ADC Info	EphA2-targeted mAb ADC A 20 (DAR8)	EphA2-targeted mAb ADC A 20 (DAR8) payload	Undisclosed	EphA2-targeted mAb ADC A 20 (DAR8) linker	[1]
ADC Info	EphA2-targeted mAb ADC A 20 (DAR4)	EphA2-targeted mAb ADC A 20 (DAR4) payload	Undisclosed	EphA2-targeted mAb ADC A 20 (DAR4) linker	[1]
ADC Info	EphA2-targeted mAb ADC A 24 (DAR8)	EphA2-targeted mAb ADC A 24 (DAR8) payload	Undisclosed	EphA2-targeted mAb ADC A 24 (DAR8) linker	[1]
ADC Info	EphA2-targeted mAb ADC A 24 (DAR4)	EphA2-targeted mAb ADC A 24 (DAR4) payload	Undisclosed	EphA2-targeted mAb ADC A 24 (DAR4) linker	[1]
ADC Info	EphA2-targeted mAb ADC A 23 (DAR8)	EphA2-targeted mAb ADC A 23 (DAR8) payload	Undisclosed	EphA2-targeted mAb ADC A 23 (DAR8) linker	[1]
ADC Info	EphA2-targeted mAb ADC A 23 (DAR4)	EphA2-targeted mAb ADC A 23 (DAR4) payload	Undisclosed	EphA2-targeted mAb ADC A 23 (DAR4) linker	[1]
ADC Info	EphA2-targeted mAb ADC 11	EphA2-targeted mAb ADC 11 payload	Undisclosed	EphA2-targeted mAb ADC 11 linker	[1]
ADC Info	EphA2-targeted mAb ADC 17	EphA2-targeted mAb ADC 17 payload	Undisclosed	EphA2-targeted mAb ADC 17 linker	[1]
ADC Info	EphA2-targeted mAb ADC 19	EphA2-targeted mAb ADC 19 payload	Undisclosed	EphA2-targeted mAb ADC 19 linker	[1]
ADC Info	EphA2-targeted mAb ADC 20	EphA2-targeted mAb ADC 20 payload	Undisclosed	EphA2-targeted mAb ADC 20 linker	[1]
ADC Info	EphA2-targeted mAb ADC 21	EphA2-targeted mAb ADC 21 payload	Undisclosed	EphA2-targeted mAb ADC 21 linker	[1]
ADC Info	EphA2-targeted mAb ADC 22	EphA2-targeted mAb ADC 22 payload	Undisclosed	EphA2-targeted mAb ADC 22 linker	[1]
ADC Info	EphA2-targeted mAb ADC 23	EphA2-targeted mAb ADC 23 payload	Undisclosed	EphA2-targeted mAb ADC 23 linker	[1]
ADC Info	EphA2-targeted mAb ADC 24	EphA2-targeted mAb ADC 24 payload	Undisclosed	EphA2-targeted mAb ADC 24 linker	[1]
ADC Info	EphA2-targeted mAb ADC 25	EphA2-targeted mAb ADC 25 payload	Undisclosed	EphA2-targeted mAb ADC 25 linker	[1]
ADC Info	EphA2-targeted mAb ADC 26	EphA2-targeted mAb ADC 26 payload	Undisclosed	EphA2-targeted mAb ADC 26 linker	[1]
ADC Info	EphA2-targeted mAb ADC 27	EphA2-targeted mAb ADC 27 payload	Undisclosed	EphA2-targeted mAb ADC 27 linker	[1]
ADC Info	EphA2-targeted mAb ADC 66	EphA2-targeted mAb ADC 66 payload	Undisclosed	EphA2-targeted mAb ADC 66 linker	[1]
ADC Info	EphA2-targeted mAb ADC 67	EphA2-targeted mAb ADC 67 payload	Undisclosed	EphA2-targeted mAb ADC 67 linker	[1]
ADC Info	EphA2-targeted mAb ADC 68	EphA2-targeted mAb ADC 68 payload	Undisclosed	EphA2-targeted mAb ADC 68 linker	[1]
ADC Info	EphA2-targeted mAb ADC 69	EphA2-targeted mAb ADC 69 payload	Undisclosed	EphA2-targeted mAb ADC 69 linker	[1]
ADC Info	EphA2-targeted mAb ADC 96	EphA2-targeted mAb ADC 96 payload	Undisclosed	EphA2-targeted mAb ADC 96 linker	[1]
ADC Info	EphA2-targeted mAb ADC 98	EphA2-targeted mAb ADC 98 payload	Undisclosed	EphA2-targeted mAb ADC 98 linker	[1]
ADC Info	EphA2-targeted mAb ADC 101	EphA2-targeted mAb ADC 101 payload	Undisclosed	EphA2-targeted mAb ADC 101 linker	[1]
ADC Info	EphA2-targeted mAb ADC 102	EphA2-targeted mAb ADC 102 payload	Undisclosed	EphA2-targeted mAb ADC 102 linker	[1]
ADC Info	EphA2-targeted mAb ADC 103	EphA2-targeted mAb ADC 103 payload	Undisclosed	EphA2-targeted mAb ADC 103 linker	[1]
ADC Info	EphA2-targeted mAb ADC 104	EphA2-targeted mAb ADC 104 payload	Undisclosed	EphA2-targeted mAb ADC 104 linker	[1]
ADC Info	EphA2-targeted mAb ADC 105	EphA2-targeted mAb ADC 105 payload	Undisclosed	EphA2-targeted mAb ADC 105 linker	[1]
ADC Info	EphA2-targeted mAb ADC 106	EphA2-targeted mAb ADC 106 payload	Undisclosed	EphA2-targeted mAb ADC 106 linker	[1]
ADC Info	EphA2-targeted mAb ADC 107	EphA2-targeted mAb ADC 107 payload	Undisclosed	EphA2-targeted mAb ADC 107 linker	[1]
ADC Info	EphA2-targeted mAb ADC 108	EphA2-targeted mAb ADC 108 payload	Undisclosed	EphA2-targeted mAb ADC 108 linker	[1]
ADC Info	EphA2-targeted mAb ADC 109	EphA2-targeted mAb ADC 109 payload	Undisclosed	EphA2-targeted mAb ADC 109 linker	[1]
ADC Info	EphA2-targeted mAb ADC 110	EphA2-targeted mAb ADC 110 payload	Undisclosed	EphA2-targeted mAb ADC 110 linker	[1]
ADC Info	EphA2-targeted mAb ADC 111	EphA2-targeted mAb ADC 111 payload	Undisclosed	EphA2-targeted mAb ADC 111 linker	[1]
ADC Info	EphA2-targeted mAb ADC 112	EphA2-targeted mAb ADC 112 payload	Undisclosed	EphA2-targeted mAb ADC 112 linker	[1]
ADC Info	EphA2-targeted mAb ADC 121	EphA2-targeted mAb ADC 121 payload	Undisclosed	EphA2-targeted mAb ADC 121 linker	[1]
ADC Info	EphA2-targeted mAb ADC 122	EphA2-targeted mAb ADC 122 payload	Undisclosed	EphA2-targeted mAb ADC 122 linker	[1]
ADC Info	EphA2-targeted mAb ADC 123	EphA2-targeted mAb ADC 123 payload	Undisclosed	EphA2-targeted mAb ADC 123 linker	[1]
ADC Info	EphA2-targeted mAb ADC 124	EphA2-targeted mAb ADC 124 payload	Undisclosed	EphA2-targeted mAb ADC 124 linker	[1]
ADC Info	EphA2-targeted mAb ADC 125	EphA2-targeted mAb ADC 125 payload	Undisclosed	EphA2-targeted mAb ADC 125 linker	[1]
ADC Info	EphA2-targeted mAb ADC 126	EphA2-targeted mAb ADC 126 payload	Undisclosed	EphA2-targeted mAb ADC 126 linker	[1]
ADC Info	EphA2-targeted mAb ADC 128	EphA2-targeted mAb ADC 128 payload	Undisclosed	EphA2-targeted mAb ADC 128 linker	[1]
ADC Info	EphA2-targeted mAb ADC 131	EphA2-targeted mAb ADC 131 payload	Undisclosed	EphA2-targeted mAb ADC 131 linker	[1]
ADC Info	EphA2-targeted mAb ADC 133	EphA2-targeted mAb ADC 133 payload	Undisclosed	EphA2-targeted mAb ADC 133 linker	[1]
ADC Info	EphA2-targeted mAb ADC 134	EphA2-targeted mAb ADC 134 payload	Undisclosed	EphA2-targeted mAb ADC 134 linker	[1]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	1C1-mcMMAF	Monomethyl auristatin F	Microtubule (MT)	Maleimido-caproyl	[2]
ADC Info	CN106459205B ADC-1	CN106459205B ADC-1 payload	Undisclosed	CN106459205B ADC-1 linker	[3]
ADC Info	CN106459205B ADC-2	CN106459205B ADC-2 payload	Undisclosed	CN106459205B ADC-2 linker	[3]
ADC Info	CN106459205B ADC-3	CN106459205B ADC-3 payload	Undisclosed	CN106459205B ADC-3 linker	[3]
ADC Info	CN106459205B ADC-4	CN106459205B ADC-4 payload	Undisclosed	CN106459205B ADC-4 linker	[3]
ADC Info	CN106459205B ADC-5	CN106459205B ADC-5 payload	Undisclosed	CN106459205B ADC-5 linker	[3]
ADC Info	MEDI-547	Monomethyl auristatin F	Microtubule (MT)	Maleimido-caproyl	[4]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	SAB-Y9-59	Undisclosed	Undisclosed	Undisclosed	[5]
ADC Info	ATRC-301	Undisclosed	Undisclosed	Undisclosed	[6]
ADC Info	SAB-Y20	Undisclosed	Undisclosed	Undisclosed	[7]
ADC Info	SAB-Y19	Undisclosed	Undisclosed	Undisclosed	[8]
ADC Info	MM-310	Docetaxel	Microtubule (MT)	Undisclosed	[9]

Differential expression pattern of antigen in diseases
The Studied Tissue	Gingival
The Specific Disease	Bacterial infection of gingival
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.096046332; Fold-change: 0.150150832; Z-score: 0.274394416
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Brainstem
The Specific Disease	Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.763217895; Fold-change: -0.403054274; Z-score: -0.339385341
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	White matter
The Specific Disease	Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.964648746; Fold-change: -0.007659103; Z-score: -0.010233824
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Brainstem
The Specific Disease	Neuroectodermal tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.27E-10; Fold-change: 0.909386817; Z-score: 3.176132127
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Nervous
The Specific Disease	Brain cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.96E-54; Fold-change: 0.515284879; Z-score: 0.97859663
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Polycythemia vera
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000151275; Fold-change: 0.119460046; Z-score: 0.791611726
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Whole blood
The Specific Disease	Myelofibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.268842068; Fold-change: 0.02301805; Z-score: 0.144429436
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Myelodysplastic syndromes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.033262676; Fold-change: 0.001341491; Z-score: 0.00816472
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.734162386; Fold-change: 0.004985145; Z-score: 0.042725718
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Tonsil
The Specific Disease	Lymphoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.955827099; Fold-change: 0.029914328; Z-score: 0.104537913
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Gastric
The Specific Disease	Gastric cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.030242485; Fold-change: 1.686112015; Z-score: 3.365209999
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.062176972; Fold-change: 0.51050761; Z-score: 0.690872767
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Colon
The Specific Disease	Colon cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.57E-32; Fold-change: 1.283315881; Z-score: 1.452041355
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 3.84E-05; Fold-change: 0.7295986; Z-score: 0.620189614
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Pancreas
The Specific Disease	Pancreatic cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000325935; Fold-change: 1.019518273; Z-score: 1.281878569
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 2.28E-24; Fold-change: 1.25881328; Z-score: 2.219117699
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Liver
The Specific Disease	Liver cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000259177; Fold-change: -0.56704047; Z-score: -0.890202045
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 7.10E-53; Fold-change: -1.347903429; Z-score: -1.756350842
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 0.003189438; Fold-change: -1.177245656; Z-score: -3.781115183
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual Download Antigen expression data in the tissue of the other disease section

Differential expression pattern of antigen in diseases
The Studied Tissue	Lung
The Specific Disease	Lung cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.82225585; Fold-change: 0.160661098; Z-score: 0.223477587
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 3.14E-06; Fold-change: -0.226423005; Z-score: -0.280180599
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Melanoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.546886402; Fold-change: -0.116106771; Z-score: -0.108351155
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Muscle
The Specific Disease	Sarcoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.31E-30; Fold-change: 0.381434949; Z-score: 1.235977447
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.202922266; Fold-change: 0.281165881; Z-score: 0.871448323
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Breast
The Specific Disease	Breast cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.28E-82; Fold-change: -0.922451591; Z-score: -1.916744845
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.28E-08; Fold-change: -0.717836389; Z-score: -1.118067559
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Ovarian
The Specific Disease	Ovarian cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.02E-05; Fold-change: 1.212928665; Z-score: 2.34625276
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.006092483; Fold-change: -0.666818612; Z-score: -0.797283224
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Cervical
The Specific Disease	Cervical cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.009640741; Fold-change: -0.566409161; Z-score: -0.821742345
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Endometrium
The Specific Disease	Uterine cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000930541; Fold-change: 0.601077843; Z-score: 0.493003443
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.002164197; Fold-change: -1.935652377; Z-score: -3.360363173
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Prostate
The Specific Disease	Prostate cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.051968678; Fold-change: -0.482419872; Z-score: -0.630347461
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bladder
The Specific Disease	Bladder cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.27E-19; Fold-change: 1.613338259; Z-score: 10.05119618
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Uvea
The Specific Disease	Retinoblastoma tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000143411; Fold-change: 1.103775523; Z-score: 2.095878728
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Thyroid
The Specific Disease	Thyroid cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.08E-20; Fold-change: 0.941226017; Z-score: 1.524716868
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 3.18E-09; Fold-change: 1.221050703; Z-score: 1.553452398
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Adrenal cortex
The Specific Disease	Adrenocortical carcinoma
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 8.38E-10; Fold-change: -0.624867122; Z-score: -1.861465491
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of the other disease section

Differential expression pattern of antigen in diseases
The Studied Tissue	Head and neck
The Specific Disease	Head and neck cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.55E-06; Fold-change: -0.30905338; Z-score: -0.478301965
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Pituitary
The Specific Disease	Pituitary gonadotrope tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.007538032; Fold-change: -0.715715128; Z-score: -1.060164094
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Pituitary
The Specific Disease	Pituitary cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.014375633; Fold-change: -0.523068992; Z-score: -0.959836389
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Thrombocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.893032326; Fold-change: 0.180230002; Z-score: 0.182316253
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Lupus erythematosus
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.36E-08; Fold-change: -0.18478003; Z-score: -0.556843473
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral monocyte
The Specific Disease	Autoimmune uveitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.126173523; Fold-change: -0.248729891; Z-score: -1.842830026
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Familial hypercholesterolemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.345885176; Fold-change: -0.145924601; Z-score: -0.80411335
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Superior temporal cortex
The Specific Disease	Schizophrenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.519742084; Fold-change: 0.010582245; Z-score: 0.051290214
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Spinal cord
The Specific Disease	Multiple sclerosis
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.492398664; Fold-change: 0.319199829; Z-score: 0.451446552
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue
The Studied Tissue	Plasmacytoid dendritic cells
The Specific Disease	Multiple sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.189661004; Fold-change: -0.039500048; Z-score: -0.133688723
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peritumoral cortex
The Specific Disease	Epilepsy
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 0.680317325; Fold-change: 0.098217565; Z-score: 0.114922134
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of the other disease section

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Cardioembolic Stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.103224854; Fold-change: 0.167249096; Z-score: 0.445048283
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Peripheral blood
The Specific Disease	Ischemic stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.675937824; Fold-change: 0.013420906; Z-score: 0.062339758
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	White matter
The Specific Disease	HIV
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.174486593; Fold-change: 0.127833336; Z-score: 0.460730352
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Influenza
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.040041736; Fold-change: -0.235461001; Z-score: -1.703608832
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Chronic hepatitis C
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.137745678; Fold-change: 0.15063636; Z-score: 1.352524474
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Sepsis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.053788063; Fold-change: -0.091980013; Z-score: -0.336944674
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Septic shock
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.98E-05; Fold-change: -0.132438223; Z-score: -0.489651837
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Pediatric respiratory syncytial virus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.131459839; Fold-change: -0.038678512; Z-score: -0.209505175
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Essential hypertension
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.49241841; Fold-change: 0.105195651; Z-score: 0.842746732
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Myocardial infarction
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.88776748; Fold-change: -0.07193114; Z-score: -0.143185041
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Coronary artery disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.090937894; Fold-change: -0.382159337; Z-score: -1.378264313
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Calcified aortic valve
The Specific Disease	Aortic stenosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.540841169; Fold-change: 0.038208094; Z-score: 0.112812081
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Arteriosclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.620558298; Fold-change: 0.081722895; Z-score: 0.368450696
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Intracranial artery
The Specific Disease	Aneurysm
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.079022078; Fold-change: 0.446861501; Z-score: 0.521428737
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Immunodeficiency
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.928017036; Fold-change: 0.027796359; Z-score: 0.244110809
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Hyperplastic tonsil
The Specific Disease	Apnea
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.61331898; Fold-change: 0.710307621; Z-score: 1.010964659
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Olive pollen allergy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000130509; Fold-change: 0.253479212; Z-score: 5.454557001
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Sinus mucosa
The Specific Disease	Chronic rhinosinusitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.03613705; Fold-change: -1.239125643; Z-score: -1.488731846
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Lung
The Specific Disease	Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.945243734; Fold-change: 0.086894953; Z-score: 0.118982046
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Small airway epithelium
The Specific Disease	Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.58E-06; Fold-change: -0.419476238; Z-score: -0.735740102
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Nasal and bronchial airway
The Specific Disease	Asthma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.046526521; Fold-change: 0.150900096; Z-score: 0.209637337
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Nasal Epithelium
The Specific Disease	Human rhinovirus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.68012808; Fold-change: 0.047856298; Z-score: 0.117206122
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Lung
The Specific Disease	Idiopathic pulmonary fibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.90920054; Fold-change: 0.273977035; Z-score: 0.41854956
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Gingival
The Specific Disease	Periodontal disease
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.059606034; Fold-change: 0.165082743; Z-score: 0.300694936
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Gastric antrum
The Specific Disease	Eosinophilic gastritis
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.145214971; Fold-change: 0.686553886; Z-score: 1.825361698
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Liver
The Specific Disease	Liver failure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.513852363; Fold-change: -0.177259373; Z-score: -0.275767173
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Colon mucosal
The Specific Disease	Ulcerative colitis
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.000790738; Fold-change: 0.644599356; Z-score: 1.07767921
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Rectal colon
The Specific Disease	Irritable bowel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.90282881; Fold-change: -0.052157386; Z-score: -0.134927141
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Atopic dermatitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.40E-06; Fold-change: 0.328084157; Z-score: 1.293952441
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Psoriasis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.73E-19; Fold-change: 1.109824683; Z-score: 1.74998354
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.39E-15; Fold-change: 0.691827615; Z-score: 1.451054264
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Vitiligo
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.014055711; Fold-change: 0.486225322; Z-score: 1.548773304
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin from scalp
The Specific Disease	Alopecia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.54E-08; Fold-change: -0.432371591; Z-score: -1.283643597
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Sensitive skin
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.563278312; Fold-change: 0.084183742; Z-score: 0.622265826
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Synovial
The Specific Disease	Osteoarthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.254373284; Fold-change: 0.846145529; Z-score: 0.675086614
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Arthropathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.875650061; Fold-change: -0.066182607; Z-score: -0.319861682
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.034285653; Fold-change: -0.087512265; Z-score: -0.272576429
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Synovial
The Specific Disease	Rheumatoid arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.29E-05; Fold-change: 0.477190709; Z-score: 3.324250862
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Pheripheral blood
The Specific Disease	Ankylosing spondylitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.170445708; Fold-change: -0.118976136; Z-score: -1.129146188
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Osteoporosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.156646718; Fold-change: 0.656431062; Z-score: 1.346923949
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Endometrium
The Specific Disease	Endometriosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.31983757; Fold-change: -0.090333359; Z-score: -0.068687586
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bladder
The Specific Disease	Interstitial cystitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.01592439; Fold-change: 0.387827252; Z-score: 2.647741974
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Myometrium
The Specific Disease	Preterm birth
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.618737094; Fold-change: -0.020715258; Z-score: -0.094760443
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Acute myelocytic leukemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.565633955; Fold-change: -0.031647628; Z-score: -0.133761274
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.050305744; Fold-change: -0.171159989; Z-score: -0.746891587
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Peripheral blood
The Specific Disease	Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.795183884; Fold-change: -0.088178101; Z-score: -0.390222655
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Oral
The Specific Disease	Oral cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.009191058; Fold-change: -0.367225058; Z-score: -0.415387928
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.034160583; Fold-change: -0.322359422; Z-score: -0.372247226
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Esophagus
The Specific Disease	Esophagal cancer
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.074065491; Fold-change: -0.6495318; Z-score: -0.796651072
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Rectal colon
The Specific Disease	Rectal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.039083871; Fold-change: 0.950409173; Z-score: 1.522824476
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.026176519; Fold-change: 1.225592485; Z-score: 1.355429519
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Skin cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000561407; Fold-change: -0.134591362; Z-score: -0.250894013
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 4.79E-09; Fold-change: -0.451769846; Z-score: -0.866781137
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Kidney
The Specific Disease	Renal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.013914053; Fold-change: 0.334525856; Z-score: 0.619506522
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.47E-06; Fold-change: 0.546122592; Z-score: 0.795229668
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Urothelium
The Specific Disease	Ureter cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.583487605; Fold-change: 0.126951359; Z-score: 0.132643336
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Adipose
The Specific Disease	Simpson golabi behmel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.542208647; Fold-change: 0.045608909; Z-score: 0.172469454
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Perituberal
The Specific Disease	Tuberous sclerosis complex
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.0272008; Fold-change: 0.528612626; Z-score: 2.967721336
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Anemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.36416184; Fold-change: -0.090632396; Z-score: -0.47996189
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Sickle cell disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.456170533; Fold-change: 0.036006238; Z-score: 0.19276444
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Thrombocythemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.008659013; Fold-change: 0.167900782; Z-score: 1.080805558
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Scleroderma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.001694248; Fold-change: 0.474194121; Z-score: 1.815107486
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Salivary gland
The Specific Disease	Sjogren syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.568134001; Fold-change: -0.156406303; Z-score: -0.349419314
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.003175368; Fold-change: -0.415437371; Z-score: -2.556168177
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Behcet disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.594810134; Fold-change: -0.01297974; Z-score: -0.036829801
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Autosomal dominant monocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.113345465; Fold-change: -0.148853575; Z-score: -1.326135866
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Liver
The Specific Disease	Type 2 diabetes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.557427663; Fold-change: 0.015424073; Z-score: 0.067532206
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Vastus lateralis muscle
The Specific Disease	Polycystic ovary syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.79914415; Fold-change: 0.098835265; Z-score: 0.542961465
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Subcutaneous Adipose
The Specific Disease	Obesity
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.67601806; Fold-change: 0.133982608; Z-score: 0.374252154
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Biceps muscle
The Specific Disease	Pompe disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.03074452; Fold-change: 0.652127453; Z-score: 1.532010415
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Batten disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.92937804; Fold-change: 0.030537859; Z-score: 0.110119713
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Autism
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.177606044; Fold-change: -0.049143916; Z-score: -0.217712418
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Anxiety disorder
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.684674824; Fold-change: -0.004961368; Z-score: -0.015952233
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Substantia nigra
The Specific Disease	Parkinson disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.769728607; Fold-change: -0.035323157; Z-score: -0.11285505
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Huntington disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.998664923; Fold-change: 0.03228522; Z-score: 0.169380183
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Entorhinal cortex
The Specific Disease	Alzheimer disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.54E-06; Fold-change: 0.18033988; Z-score: 0.641130722
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Seizure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.571354224; Fold-change: 0.011334196; Z-score: 0.043421958
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.251657193; Fold-change: 0.393302035; Z-score: 0.95853088
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Cervical spinal cord
The Specific Disease	Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.218138048; Fold-change: 0.143522258; Z-score: 0.330797415
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Muscle
The Specific Disease	Muscular atrophy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.05684851; Fold-change: 0.123851789; Z-score: 0.310650266
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Muscle
The Specific Disease	Myopathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.734562509; Fold-change: -0.03418859; Z-score: -0.262871323
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Ref 1	Immunomodulatory antibody-drug conjugates; 2022-07-21.
Ref 2	Introduction to basic information on ADC drug 1C1-mcMMAF
Ref 3	Conjugated compounds comprising cysteine engineered antibodies.
Ref 4	Phase 1, open-label study of MEDI-547 in patients with relapsed or refractory solid tumors. Invest New Drugs. 2013 Feb;31(1):77-84.
Ref 5	Syntab therapeutics biotechnology company product pipeline
Ref 6	ATRC-301: a novel EphA2-targeting ADC binding a unique epitope
Ref 7	Introduction to basic information on ADC drug SAB-Y20.
Ref 8	Introduction to basic information on ADC drug SAB-Y19.
Ref 9	A phase 1 study evaluating the safety, pharmacology and preliminary activity of MM-310 in patients with solid tumors. Journal of Clinical Oncology 2018 36:15_suppl, TPS2604-TPS2604.