General Information of This Antigen
Antigen ID
TAR0GFSKS
Antigen Name
Ephrin type-A receptor 2 (EPHA2)
Gene Name
EPHA2
Gene ID
1969
Synonym
ECK; Epithelial cell kinase;Tyrosine-protein kinase receptor ECK
Sequence
MELQAARACFALLWGCALAAAAAAQGKEVVLLDFAAAGGELGWLTHPYGKGWDLMQNIMN
DMPIYMYSVCNVMSGDQDNWLRTNWVYRGEAERIFIELKFTVRDCNSFPGGASSCKETFN
LYYAESDLDYGTNFQKRLFTKIDTIAPDEITVSSDFEARHVKLNVEERSVGPLTRKGFYL
AFQDIGACVALLSVRVYYKKCPELLQGLAHFPETIAGSDAPSLATVAGTCVDHAVVPPGG
EEPRMHCAVDGEWLVPIGQCLCQAGYEKVEDACQACSPGFFKFEASESPCLECPEHTLPS
PEGATSCECEEGFFRAPQDPASMPCTRPPSAPHYLTAVGMGAKVELRWTPPQDSGGREDI
VYSVTCEQCWPESGECGPCEASVRYSEPPHGLTRTSVTVSDLEPHMNYTFTVEARNGVSG
LVTSRSFRTASVSINQTEPPKVRLEGRSTTSLSVSWSIPPPQQSRVWKYEVTYRKKGDSN
SYNVRRTEGFSVTLDDLAPDTTYLVQVQALTQEGQGAGSKVHEFQTLSPEGSGNLAVIGG
VAVGVVLLLVLAGVGFFIHRRRKNQRARQSPEDVYFSKSEQLKPLKTYVDPHTYEDPNQA
VLKFTTEIHPSCVTRQKVIGAGEFGEVYKGMLKTSSGKKEVPVAIKTLKAGYTEKQRVDF
LGEAGIMGQFSHHNIIRLEGVISKYKPMMIITEYMENGALDKFLREKDGEFSVLQLVGML
RGIAAGMKYLANMNYVHRDLAARNILVNSNLVCKVSDFGLSRVLEDDPEATYTTSGGKIP
IRWTAPEAISYRKFTSASDVWSFGIVMWEVMTYGERPYWELSNHEVMKAINDGFRLPTPM
DCPSAIYQLMMQCWQQERARRPKFADIVSILDKLIRAPDSLKTLADFDPRVSIRLPSTSG
SEGVPFRTVSEWLESIKMQQYTEHFMAAGYTAIEKVVQMTNDDIKRIGVRLPGHQKRIAY
SLLGLKDQVNTVGIPI

    Click to Show/Hide
Family
Tyr protein family
Function
Receptor tyrosine kinase which binds promiscuously membrane- bound ephrin-A family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Activated by the ligand ephrin- A1/EFNA1 regulates migration, integrin-mediated adhesion, proliferation and differentiation of cells. Regulates cell adhesion and differentiation through DSG1/desmoglein-1 and inhibition of the ERK1/ERK2 (MAPK3/MAPK1, respectively) signaling pathway. May also participate in UV radiation-induced apoptosis and have a ligand- independent stimulatory effect on chemotactic cell migration. During development, may function in distinctive aspects of pattern formation and subsequently in development of several fetal tissues. Involved for instance in angiogenesis, in early hindbrain development and epithelial proliferation and branching morphogenesis during mammary gland development. Engaged by the ligand ephrin-A5/EFNA5 may regulate lens fiber cells shape and interactions and be important for lens transparency development and maintenance. With ephrin-A2/EFNA2 may play a role in bone remodeling through regulation of osteoclastogenesis and osteoblastogenesis.

    Click to Show/Hide
Uniprot Entry
EPHA2_HUMAN
HGNC ID
HGNC:3386
KEGG ID
hsa:1969
Each Antibody-drug Conjuate AND It's Component Related to This Antigen
Full List of The ADC Related to This Antigen
Anti-EPHA2 mAb
ADC Info ADC Name Payload Target Linker Ref
EphA2-targeted mAb ADC 101
EphA2-targeted mAb ADC 101 payload
Undisclosed
EphA2-targeted mAb ADC 101 linker
[1]
EphA2-targeted mAb ADC 102
EphA2-targeted mAb ADC 102 payload
Undisclosed
EphA2-targeted mAb ADC 102 linker
[1]
EphA2-targeted mAb ADC 103
EphA2-targeted mAb ADC 103 payload
Undisclosed
EphA2-targeted mAb ADC 103 linker
[1]
EphA2-targeted mAb ADC 104
EphA2-targeted mAb ADC 104 payload
Undisclosed
EphA2-targeted mAb ADC 104 linker
[1]
EphA2-targeted mAb ADC 105
EphA2-targeted mAb ADC 105 payload
Undisclosed
EphA2-targeted mAb ADC 105 linker
[1]
EphA2-targeted mAb ADC 106
EphA2-targeted mAb ADC 106 payload
Undisclosed
EphA2-targeted mAb ADC 106 linker
[1]
EphA2-targeted mAb ADC 107
EphA2-targeted mAb ADC 107 payload
Undisclosed
EphA2-targeted mAb ADC 107 linker
[1]
EphA2-targeted mAb ADC 108
EphA2-targeted mAb ADC 108 payload
Undisclosed
EphA2-targeted mAb ADC 108 linker
[1]
EphA2-targeted mAb ADC 109
EphA2-targeted mAb ADC 109 payload
Undisclosed
EphA2-targeted mAb ADC 109 linker
[1]
EphA2-targeted mAb ADC 11
EphA2-targeted mAb ADC 11 payload
Undisclosed
EphA2-targeted mAb ADC 11 linker
[1]
EphA2-targeted mAb ADC 110
EphA2-targeted mAb ADC 110 payload
Undisclosed
EphA2-targeted mAb ADC 110 linker
[1]
EphA2-targeted mAb ADC 111
EphA2-targeted mAb ADC 111 payload
Undisclosed
EphA2-targeted mAb ADC 111 linker
[1]
EphA2-targeted mAb ADC 112
EphA2-targeted mAb ADC 112 payload
Undisclosed
EphA2-targeted mAb ADC 112 linker
[1]
EphA2-targeted mAb ADC 121
EphA2-targeted mAb ADC 121 payload
Undisclosed
EphA2-targeted mAb ADC 121 linker
[1]
EphA2-targeted mAb ADC 122
EphA2-targeted mAb ADC 122 payload
Undisclosed
EphA2-targeted mAb ADC 122 linker
[1]
EphA2-targeted mAb ADC 123
EphA2-targeted mAb ADC 123 payload
Undisclosed
EphA2-targeted mAb ADC 123 linker
[1]
EphA2-targeted mAb ADC 124
EphA2-targeted mAb ADC 124 payload
Undisclosed
EphA2-targeted mAb ADC 124 linker
[1]
EphA2-targeted mAb ADC 125
EphA2-targeted mAb ADC 125 payload
Undisclosed
EphA2-targeted mAb ADC 125 linker
[1]
EphA2-targeted mAb ADC 126
EphA2-targeted mAb ADC 126 payload
Undisclosed
EphA2-targeted mAb ADC 126 linker
[1]
EphA2-targeted mAb ADC 128
EphA2-targeted mAb ADC 128 payload
Undisclosed
EphA2-targeted mAb ADC 128 linker
[1]
EphA2-targeted mAb ADC 131
EphA2-targeted mAb ADC 131 payload
Undisclosed
EphA2-targeted mAb ADC 131 linker
[1]
EphA2-targeted mAb ADC 133
EphA2-targeted mAb ADC 133 payload
Undisclosed
EphA2-targeted mAb ADC 133 linker
[1]
EphA2-targeted mAb ADC 134
EphA2-targeted mAb ADC 134 payload
Undisclosed
EphA2-targeted mAb ADC 134 linker
[1]
EphA2-targeted mAb ADC 144
EphA2-targeted mAb ADC 144 payload
Undisclosed
EphA2-targeted mAb ADC 144 linker
[1]
EphA2-targeted mAb ADC 145
EphA2-targeted mAb ADC 145 payload
Undisclosed
EphA2-targeted mAb ADC 145 linker
[1]
EphA2-targeted mAb ADC 146
EphA2-targeted mAb ADC 146 payload
Undisclosed
EphA2-targeted mAb ADC 146 linker
[1]
EphA2-targeted mAb ADC 147
EphA2-targeted mAb ADC 147 payload
Undisclosed
EphA2-targeted mAb ADC 147 linker
[1]
EphA2-targeted mAb ADC 148
EphA2-targeted mAb ADC 148 payload
Undisclosed
EphA2-targeted mAb ADC 148 linker
[1]
EphA2-targeted mAb ADC 149
EphA2-targeted mAb ADC 149 payload
Undisclosed
EphA2-targeted mAb ADC 149 linker
[1]
EphA2-targeted mAb ADC 150
EphA2-targeted mAb ADC 150 payload
Undisclosed
EphA2-targeted mAb ADC 150 linker
[1]
EphA2-targeted mAb ADC 151
EphA2-targeted mAb ADC 151 payload
Undisclosed
EphA2-targeted mAb ADC 151 linker
[1]
EphA2-targeted mAb ADC 152
EphA2-targeted mAb ADC 152 payload
Undisclosed
EphA2-targeted mAb ADC 152 linker
[1]
EphA2-targeted mAb ADC 17
EphA2-targeted mAb ADC 17 payload
Undisclosed
EphA2-targeted mAb ADC 17 linker
[1]
EphA2-targeted mAb ADC 19
EphA2-targeted mAb ADC 19 payload
Undisclosed
EphA2-targeted mAb ADC 19 linker
[1]
EphA2-targeted mAb ADC 20
EphA2-targeted mAb ADC 20 payload
Undisclosed
EphA2-targeted mAb ADC 20 linker
[1]
EphA2-targeted mAb ADC 21
EphA2-targeted mAb ADC 21 payload
Undisclosed
EphA2-targeted mAb ADC 21 linker
[1]
EphA2-targeted mAb ADC 22
EphA2-targeted mAb ADC 22 payload
Undisclosed
EphA2-targeted mAb ADC 22 linker
[1]
EphA2-targeted mAb ADC 23
EphA2-targeted mAb ADC 23 payload
Undisclosed
EphA2-targeted mAb ADC 23 linker
[1]
EphA2-targeted mAb ADC 24
EphA2-targeted mAb ADC 24 payload
Undisclosed
EphA2-targeted mAb ADC 24 linker
[1]
EphA2-targeted mAb ADC 25
EphA2-targeted mAb ADC 25 payload
Undisclosed
EphA2-targeted mAb ADC 25 linker
[1]
EphA2-targeted mAb ADC 26
EphA2-targeted mAb ADC 26 payload
Undisclosed
EphA2-targeted mAb ADC 26 linker
[1]
EphA2-targeted mAb ADC 27
EphA2-targeted mAb ADC 27 payload
Undisclosed
EphA2-targeted mAb ADC 27 linker
[1]
EphA2-targeted mAb ADC 66
EphA2-targeted mAb ADC 66 payload
Undisclosed
EphA2-targeted mAb ADC 66 linker
[1]
EphA2-targeted mAb ADC 67
EphA2-targeted mAb ADC 67 payload
Undisclosed
EphA2-targeted mAb ADC 67 linker
[1]
EphA2-targeted mAb ADC 68
EphA2-targeted mAb ADC 68 payload
Undisclosed
EphA2-targeted mAb ADC 68 linker
[1]
EphA2-targeted mAb ADC 69
EphA2-targeted mAb ADC 69 payload
Undisclosed
EphA2-targeted mAb ADC 69 linker
[1]
EphA2-targeted mAb ADC 96
EphA2-targeted mAb ADC 96 payload
Undisclosed
EphA2-targeted mAb ADC 96 linker
[1]
EphA2-targeted mAb ADC 98
EphA2-targeted mAb ADC 98 payload
Undisclosed
EphA2-targeted mAb ADC 98 linker
[1]
EphA2-targeted mAb ADC A 12 (DAR4)
EphA2-targeted mAb ADC A 12 (DAR4) payload
Undisclosed
EphA2-targeted mAb ADC A 12 (DAR4) linker
[1]
EphA2-targeted mAb ADC A 12 (DAR8)
EphA2-targeted mAb ADC A 12 (DAR8) payload
Undisclosed
EphA2-targeted mAb ADC A 12 (DAR8) linker
[1]
EphA2-targeted mAb ADC A 17 (DAR4)
EphA2-targeted mAb ADC A 17 (DAR4) payload
Undisclosed
EphA2-targeted mAb ADC A 17 (DAR4) linker
[1]
EphA2-targeted mAb ADC A 17 (DAR8)
EphA2-targeted mAb ADC A 17 (DAR8) payload
Undisclosed
EphA2-targeted mAb ADC A 17 (DAR8) linker
[1]
EphA2-targeted mAb ADC A 19 (DAR4)
EphA2-targeted mAb ADC A 19 (DAR4) payload
Undisclosed
EphA2-targeted mAb ADC A 19 (DAR4) linker
[1]
EphA2-targeted mAb ADC A 19 (DAR8)
EphA2-targeted mAb ADC A 19 (DAR8) payload
Undisclosed
EphA2-targeted mAb ADC A 19 (DAR8) linker
[1]
EphA2-targeted mAb ADC A 20 (DAR4)
EphA2-targeted mAb ADC A 20 (DAR4) payload
Undisclosed
EphA2-targeted mAb ADC A 20 (DAR4) linker
[1]
EphA2-targeted mAb ADC A 20 (DAR8)
EphA2-targeted mAb ADC A 20 (DAR8) payload
Undisclosed
EphA2-targeted mAb ADC A 20 (DAR8) linker
[1]
EphA2-targeted mAb ADC A 21 (DAR4)
EphA2-targeted mAb ADC A 21 (DAR4) payload
Undisclosed
EphA2-targeted mAb ADC A 21 (DAR4) linker
[1]
EphA2-targeted mAb ADC A 21 (DAR8)
EphA2-targeted mAb ADC A 21 (DAR8) payload
Undisclosed
EphA2-targeted mAb ADC A 21 (DAR8) linker
[1]
EphA2-targeted mAb ADC A 22 (DAR2)
EphA2-targeted mAb ADC A 22 (DAR2) payload
Undisclosed
EphA2-targeted mAb ADC A 22 (DAR2) linker
[1]
EphA2-targeted mAb ADC A 22 (DAR6)
EphA2-targeted mAb ADC A 22 (DAR6) payload
Undisclosed
EphA2-targeted mAb ADC A 22 (DAR6) linker
[1]
EphA2-targeted mAb ADC A 23 (DAR4)
EphA2-targeted mAb ADC A 23 (DAR4) payload
Undisclosed
EphA2-targeted mAb ADC A 23 (DAR4) linker
[1]
EphA2-targeted mAb ADC A 23 (DAR8)
EphA2-targeted mAb ADC A 23 (DAR8) payload
Undisclosed
EphA2-targeted mAb ADC A 23 (DAR8) linker
[1]
EphA2-targeted mAb ADC A 24 (DAR4)
EphA2-targeted mAb ADC A 24 (DAR4) payload
Undisclosed
EphA2-targeted mAb ADC A 24 (DAR4) linker
[1]
EphA2-targeted mAb ADC A 24 (DAR8)
EphA2-targeted mAb ADC A 24 (DAR8) payload
Undisclosed
EphA2-targeted mAb ADC A 24 (DAR8) linker
[1]
Anti-EPHA2 mAb 1C1
ADC Info ADC Name Payload Target Linker Ref
MEDI-547
Monomethyl auristatin F
Microtubule (MT)
Maleimido-caproyl
[2]
1C1-mcMMAF
Monomethyl auristatin F
Microtubule (MT)
Maleimido-caproyl
[3]
CN106459205B ADC-1
CN106459205B ADC-1 payload
Undisclosed
CN106459205B ADC-1 linker
[4]
CN106459205B ADC-2
CN106459205B ADC-2 payload
Undisclosed
CN106459205B ADC-2 linker
[4]
CN106459205B ADC-3
CN106459205B ADC-3 payload
Undisclosed
CN106459205B ADC-3 linker
[4]
CN106459205B ADC-4
CN106459205B ADC-4 payload
Undisclosed
CN106459205B ADC-4 linker
[4]
CN106459205B ADC-5
CN106459205B ADC-5 payload
Undisclosed
CN106459205B ADC-5 linker
[4]
Undisclosed
ADC Info ADC Name Payload Target Linker Ref
MM-310
Docetaxel
Microtubule (MT)
Undisclosed
[5]
ATRC-301
Undisclosed
Undisclosed
Undisclosed
[6]
SAB-Y9-59
Undisclosed
Undisclosed
Undisclosed
[7]
SAB-Y19
Undisclosed
Undisclosed
Undisclosed
[8]
SAB-Y20
Undisclosed
Undisclosed
Undisclosed
[9]
Tissue/Disease specific Abundances of This Antigen
Tissue specific Abundances of This Antigen
ICD Disease Classification 01
Click to Show/Hide the 1 Disease of This Class
Bacterial infection [ICD-11: 1A00-1C4Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gingival
The Specific Disease Bacterial infection of gingival
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.096046332; Fold-change: 0.150150832; Z-score: 0.274394416
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 02
Click to Show/Hide the 22 Disease of This Class
Brain cancer [ICD-11: 2A00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Brainstem
The Specific Disease Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.763217895; Fold-change: -0.403054274; Z-score: -0.339385341
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue White matter
The Specific Disease Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.964648746; Fold-change: -0.007659103; Z-score: -0.010233824
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Brainstem
The Specific Disease Neuroectodermal tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 2.27E-10; Fold-change: 0.909386817; Z-score: 3.176132127
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Nervous
The Specific Disease Brain cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 3.96E-54; Fold-change: 0.515284879; Z-score: 0.97859663
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic myeloid leukemia [ICD-11: 2A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Polycythemia vera
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000151275; Fold-change: 0.119460046; Z-score: 0.791611726
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Whole blood
The Specific Disease Myelofibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.268842068; Fold-change: 0.02301805; Z-score: 0.144429436
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
MyeloDysplastic syndromes [ICD-11: 2A37]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Myelodysplastic syndromes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.033262676; Fold-change: 0.001341491; Z-score: 0.00816472
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.734162386; Fold-change: 0.004985145; Z-score: 0.042725718
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Lymphoma [ICD-11: 2A90- 2A85]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Tonsil
The Specific Disease Lymphoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.955827099; Fold-change: 0.029914328; Z-score: 0.104537913
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Gastric cancer [ICD-11: 2B72]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gastric
The Specific Disease Gastric cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.030242485; Fold-change: 1.686112015; Z-score: 3.365209999
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.062176972; Fold-change: 0.51050761; Z-score: 0.690872767
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Colon cancer [ICD-11: 2B90]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Colon
The Specific Disease Colon cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 6.57E-32; Fold-change: 1.283315881; Z-score: 1.452041355
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 3.84E-05; Fold-change: 0.7295986; Z-score: 0.620189614
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pancreatic cancer [ICD-11: 2C10]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Pancreas
The Specific Disease Pancreatic cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000325935; Fold-change: 1.019518273; Z-score: 1.281878569
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 2.28E-24; Fold-change: 1.25881328; Z-score: 2.219117699
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Liver cancer [ICD-11: 2C12]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Liver
The Specific Disease Liver cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000259177; Fold-change: -0.56704047; Z-score: -0.890202045
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 7.10E-53; Fold-change: -1.347903429; Z-score: -1.756350842
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 0.003189438; Fold-change: -1.177245656; Z-score: -3.781115183
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Lung cancer [ICD-11: 2C25]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Lung
The Specific Disease Lung cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.82225585; Fold-change: 0.160661098; Z-score: 0.223477587
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 3.14E-06; Fold-change: -0.226423005; Z-score: -0.280180599
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Melanoma [ICD-11: 2C30]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Melanoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.546886402; Fold-change: -0.116106771; Z-score: -0.108351155
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sarcoma [ICD-11: 2C35]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Muscle
The Specific Disease Sarcoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.31E-30; Fold-change: 0.381434949; Z-score: 1.235977447
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.202922266; Fold-change: 0.281165881; Z-score: 0.871448323
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Breast cancer [ICD-11: 2C60]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Breast
The Specific Disease Breast cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 5.28E-82; Fold-change: -0.922451591; Z-score: -1.916744845
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 1.28E-08; Fold-change: -0.717836389; Z-score: -1.118067559
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ovarian cancer [ICD-11: 2C73]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Ovarian
The Specific Disease Ovarian cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 7.02E-05; Fold-change: 1.212928665; Z-score: 2.34625276
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.006092483; Fold-change: -0.666818612; Z-score: -0.797283224
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Cervical cancer [ICD-11: 2C77]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Cervical
The Specific Disease Cervical cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.009640741; Fold-change: -0.566409161; Z-score: -0.821742345
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Uterine cancer [ICD-11: 2C78]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Endometrium
The Specific Disease Uterine cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000930541; Fold-change: 0.601077843; Z-score: 0.493003443
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.002164197; Fold-change: -1.935652377; Z-score: -3.360363173
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Prostate cancer [ICD-11: 2C82]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Prostate
The Specific Disease Prostate cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.051968678; Fold-change: -0.482419872; Z-score: -0.630347461
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Bladder cancer [ICD-11: 2C94]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bladder
The Specific Disease Bladder cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 5.27E-19; Fold-change: 1.613338259; Z-score: 10.05119618
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Retina cancer [ICD-11: 2D02]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Uvea
The Specific Disease Retinoblastoma tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000143411; Fold-change: 1.103775523; Z-score: 2.095878728
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Thyroid cancer [ICD-11: 2D10]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Thyroid
The Specific Disease Thyroid cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 2.08E-20; Fold-change: 0.941226017; Z-score: 1.524716868
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 3.18E-09; Fold-change: 1.221050703; Z-score: 1.553452398
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Adrenal cancer [ICD-11: 2D11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Adrenal cortex
The Specific Disease Adrenocortical carcinoma
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 8.38E-10; Fold-change: -0.624867122; Z-score: -1.861465491
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Head and neck cancer [ICD-11: 2D42]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Head and neck
The Specific Disease Head and neck cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 8.55E-06; Fold-change: -0.30905338; Z-score: -0.478301965
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pituitary cancer [ICD-11: 2F37]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Pituitary
The Specific Disease Pituitary gonadotrope tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.007538032; Fold-change: -0.715715128; Z-score: -1.060164094
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Pituitary
The Specific Disease Pituitary cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.014375633; Fold-change: -0.523068992; Z-score: -0.959836389
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 03
Click to Show/Hide the 1 Disease of This Class
Thrombocytopenia [ICD-11: 3B64]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Thrombocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.893032326; Fold-change: 0.180230002; Z-score: 0.182316253
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 04
Click to Show/Hide the 2 Disease of This Class
Lupus erythematosus [ICD-11: 4A40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Lupus erythematosus
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.36E-08; Fold-change: -0.18478003; Z-score: -0.556843473
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Autoimmune disease [ICD-11: 4A4Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral monocyte
The Specific Disease Autoimmune uveitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.126173523; Fold-change: -0.248729891; Z-score: -1.842830026
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 05
Click to Show/Hide the 1 Disease of This Class
Hyperlipoproteinaemia [ICD-11: 5C80]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Familial hypercholesterolemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.345885176; Fold-change: -0.145924601; Z-score: -0.80411335
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 06
Click to Show/Hide the 1 Disease of This Class
Schizophrenia [ICD-11: 6A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Superior temporal cortex
The Specific Disease Schizophrenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.519742084; Fold-change: 0.010582245; Z-score: 0.051290214
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 08
Click to Show/Hide the 3 Disease of This Class
Multiple sclerosis [ICD-11: 8A40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Spinal cord
The Specific Disease Multiple sclerosis
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.492398664; Fold-change: 0.319199829; Z-score: 0.451446552
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Plasmacytoid dendritic cells
The Specific Disease Multiple sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.189661004; Fold-change: -0.039500048; Z-score: -0.133688723
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Epilepsy [ICD-11: 8A60]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peritumoral cortex
The Specific Disease Epilepsy
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 0.680317325; Fold-change: 0.098217565; Z-score: 0.114922134
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Cerebral ischaemic stroke [ICD-11: 8B11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Cardioembolic Stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.103224854; Fold-change: 0.167249096; Z-score: 0.445048283
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Peripheral blood
The Specific Disease Ischemic stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.675937824; Fold-change: 0.013420906; Z-score: 0.062339758
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 1
Click to Show/Hide the 6 Disease of This Class
HIV [ICD-11: 1C60-1C62]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue White matter
The Specific Disease HIV
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.174486593; Fold-change: 0.127833336; Z-score: 0.460730352
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Influenza [ICD-11: 1E30]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Influenza
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.040041736; Fold-change: -0.235461001; Z-score: -1.703608832
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic hepatitis C [ICD-11: 1E51.1]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Chronic hepatitis C
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.137745678; Fold-change: 0.15063636; Z-score: 1.352524474
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sepsis [ICD-11: 1G40-1G41]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Sepsis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.053788063; Fold-change: -0.091980013; Z-score: -0.336944674
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Septic shock [ICD-11: 1G41]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Septic shock
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 2.98E-05; Fold-change: -0.132438223; Z-score: -0.489651837
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pediatric respiratory syncytial virus infection [ICD-11: CA40.11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Pediatric respiratory syncytial virus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.131459839; Fold-change: -0.038678512; Z-score: -0.209505175
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 11
Click to Show/Hide the 6 Disease of This Class
Essential hypertension [ICD-11: BA00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Essential hypertension
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.49241841; Fold-change: 0.105195651; Z-score: 0.842746732
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Myocardial infarction [ICD-11: BA41]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Myocardial infarction
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.88776748; Fold-change: -0.07193114; Z-score: -0.143185041
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Coronary artery disease [ICD-11: BA8Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Coronary artery disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.090937894; Fold-change: -0.382159337; Z-score: -1.378264313
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Aortic stenosis [ICD-11: BB70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Calcified aortic valve
The Specific Disease Aortic stenosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.540841169; Fold-change: 0.038208094; Z-score: 0.112812081
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Arteriosclerosis [ICD-11: BD40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Arteriosclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.620558298; Fold-change: 0.081722895; Z-score: 0.368450696
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Aneurysm [ICD-11: BD50]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Intracranial artery
The Specific Disease Aneurysm
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.079022078; Fold-change: 0.446861501; Z-score: 0.521428737
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 12
Click to Show/Hide the 8 Disease of This Class
Immunodeficiency [ICD-11: 4A00-4A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Immunodeficiency
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.928017036; Fold-change: 0.027796359; Z-score: 0.244110809
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Apnea [ICD-11: 7A40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Hyperplastic tonsil
The Specific Disease Apnea
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.61331898; Fold-change: 0.710307621; Z-score: 1.010964659
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Olive pollen allergy [ICD-11: CA08.00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Olive pollen allergy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000130509; Fold-change: 0.253479212; Z-score: 5.454557001
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic rhinosinusitis [ICD-11: CA0A]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Sinus mucosa
The Specific Disease Chronic rhinosinusitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.03613705; Fold-change: -1.239125643; Z-score: -1.488731846
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic obstructive pulmonary disease [ICD-11: CA22]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Lung
The Specific Disease Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.945243734; Fold-change: 0.086894953; Z-score: 0.118982046
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Small airway epithelium
The Specific Disease Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 4.58E-06; Fold-change: -0.419476238; Z-score: -0.735740102
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Asthma [ICD-11: CA23]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Nasal and bronchial airway
The Specific Disease Asthma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.046526521; Fold-change: 0.150900096; Z-score: 0.209637337
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Human rhinovirus infection [ICD-11: CA42]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Nasal Epithelium
The Specific Disease Human rhinovirus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.68012808; Fold-change: 0.047856298; Z-score: 0.117206122
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Idiopathic pulmonary fibrosis [ICD-11: CB03.4]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Lung
The Specific Disease Idiopathic pulmonary fibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.90920054; Fold-change: 0.273977035; Z-score: 0.41854956
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 13
Click to Show/Hide the 5 Disease of This Class
Periodontal disease [ICD-11: DA0C]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gingival
The Specific Disease Periodontal disease
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.059606034; Fold-change: 0.165082743; Z-score: 0.300694936
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Eosinophilic gastritis [ICD-11: DA42.2]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gastric antrum
The Specific Disease Eosinophilic gastritis
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.145214971; Fold-change: 0.686553886; Z-score: 1.825361698
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Liver failure [ICD-11: DB99.7-DB99.8]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Liver
The Specific Disease Liver failure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.513852363; Fold-change: -0.177259373; Z-score: -0.275767173
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ulcerative colitis [ICD-11: DD71]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Colon mucosal
The Specific Disease Ulcerative colitis
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.000790738; Fold-change: 0.644599356; Z-score: 1.07767921
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Irritable bowel syndrome [ICD-11: DD91.0]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Rectal colon
The Specific Disease Irritable bowel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.90282881; Fold-change: -0.052157386; Z-score: -0.134927141
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 14
Click to Show/Hide the 5 Disease of This Class
Atopic dermatitis [ICD-11: EA80]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Atopic dermatitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.40E-06; Fold-change: 0.328084157; Z-score: 1.293952441
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Psoriasis [ICD-11: EA90]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Psoriasis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 6.73E-19; Fold-change: 1.109824683; Z-score: 1.74998354
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 1.39E-15; Fold-change: 0.691827615; Z-score: 1.451054264
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Vitiligo [ICD-11: ED63.0]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Vitiligo
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.014055711; Fold-change: 0.486225322; Z-score: 1.548773304
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Alopecia [ICD-11: ED70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin from scalp
The Specific Disease Alopecia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.54E-08; Fold-change: -0.432371591; Z-score: -1.283643597
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sensitive skin [ICD-11: EK0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Sensitive skin
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.563278312; Fold-change: 0.084183742; Z-score: 0.622265826
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 15
Click to Show/Hide the 6 Disease of This Class
Osteoarthritis [ICD-11: FA00-FA0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Synovial
The Specific Disease Osteoarthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.254373284; Fold-change: 0.846145529; Z-score: 0.675086614
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Arthropathy [ICD-11: FA00-FA5Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Arthropathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.875650061; Fold-change: -0.066182607; Z-score: -0.319861682
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Arthritis [ICD-11: FA20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.034285653; Fold-change: -0.087512265; Z-score: -0.272576429
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Rheumatoid arthritis [ICD-11: FA20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Synovial
The Specific Disease Rheumatoid arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.29E-05; Fold-change: 0.477190709; Z-score: 3.324250862
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ankylosing spondylitis [ICD-11: FA92.0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Pheripheral blood
The Specific Disease Ankylosing spondylitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.170445708; Fold-change: -0.118976136; Z-score: -1.129146188
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Osteoporosis [ICD-11: FB83]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Osteoporosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.156646718; Fold-change: 0.656431062; Z-score: 1.346923949
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 16
Click to Show/Hide the 2 Disease of This Class
Endometriosis [ICD-11: GA10]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Endometrium
The Specific Disease Endometriosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.31983757; Fold-change: -0.090333359; Z-score: -0.068687586
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Interstitial cystitis [ICD-11: GC00.3]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bladder
The Specific Disease Interstitial cystitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.01592439; Fold-change: 0.387827252; Z-score: 2.647741974
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 19
Click to Show/Hide the 1 Disease of This Class
Preterm birth [ICD-11: KA21.4Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Myometrium
The Specific Disease Preterm birth
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.618737094; Fold-change: -0.020715258; Z-score: -0.094760443
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 2
Click to Show/Hide the 8 Disease of This Class
Acute myelocytic leukemia [ICD-11: 2A60]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Acute myelocytic leukemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.565633955; Fold-change: -0.031647628; Z-score: -0.133761274
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Myeloma [ICD-11: 2A83]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.050305744; Fold-change: -0.171159989; Z-score: -0.746891587
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Peripheral blood
The Specific Disease Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.795183884; Fold-change: -0.088178101; Z-score: -0.390222655
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Oral cancer [ICD-11: 2B6E]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Oral
The Specific Disease Oral cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.009191058; Fold-change: -0.367225058; Z-score: -0.415387928
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.034160583; Fold-change: -0.322359422; Z-score: -0.372247226
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Esophagal cancer [ICD-11: 2B70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Esophagus
The Specific Disease Esophagal cancer
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.074065491; Fold-change: -0.6495318; Z-score: -0.796651072
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Rectal cancer [ICD-11: 2B92]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Rectal colon
The Specific Disease Rectal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.039083871; Fold-change: 0.950409173; Z-score: 1.522824476
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.026176519; Fold-change: 1.225592485; Z-score: 1.355429519
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Skin cancer [ICD-11: 2C30-2C3Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Skin cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000561407; Fold-change: -0.134591362; Z-score: -0.250894013
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 4.79E-09; Fold-change: -0.451769846; Z-score: -0.866781137
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Renal cancer [ICD-11: 2C90-2C91]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Kidney
The Specific Disease Renal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.013914053; Fold-change: 0.334525856; Z-score: 0.619506522
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 1.47E-06; Fold-change: 0.546122592; Z-score: 0.795229668
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ureter cancer [ICD-11: 2C92]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Urothelium
The Specific Disease Ureter cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.583487605; Fold-change: 0.126951359; Z-score: 0.132643336
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 20
Click to Show/Hide the 2 Disease of This Class
Simpson golabi behmel syndrome [ICD-11: LD2C]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Adipose
The Specific Disease Simpson golabi behmel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.542208647; Fold-change: 0.045608909; Z-score: 0.172469454
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Tuberous sclerosis complex [ICD-11: LD2D.2]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Perituberal
The Specific Disease Tuberous sclerosis complex
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.0272008; Fold-change: 0.528612626; Z-score: 2.967721336
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 3
Click to Show/Hide the 3 Disease of This Class
Anemia [ICD-11: 3A00-3A9Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Anemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.36416184; Fold-change: -0.090632396; Z-score: -0.47996189
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sickle cell disease [ICD-11: 3A51.0-3A51.3]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Sickle cell disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.456170533; Fold-change: 0.036006238; Z-score: 0.19276444
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Thrombocythemia [ICD-11: 3B63]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Thrombocythemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.008659013; Fold-change: 0.167900782; Z-score: 1.080805558
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 4
Click to Show/Hide the 4 Disease of This Class
Scleroderma [ICD-11: 4A42.Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Scleroderma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.001694248; Fold-change: 0.474194121; Z-score: 1.815107486
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sjogren syndrome [ICD-11: 4A43]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Salivary gland
The Specific Disease Sjogren syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.568134001; Fold-change: -0.156406303; Z-score: -0.349419314
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.003175368; Fold-change: -0.415437371; Z-score: -2.556168177
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Behcet disease [ICD-11: 4A62]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Behcet disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.594810134; Fold-change: -0.01297974; Z-score: -0.036829801
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Autosomal dominant monocytopenia [ICD-11: 4B04]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Autosomal dominant monocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.113345465; Fold-change: -0.148853575; Z-score: -1.326135866
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 5
Click to Show/Hide the 5 Disease of This Class
Type 2 diabetes [ICD-11: 5A11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Liver
The Specific Disease Type 2 diabetes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.557427663; Fold-change: 0.015424073; Z-score: 0.067532206
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Polycystic ovary syndrome [ICD-11: 5A80.1]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Vastus lateralis muscle
The Specific Disease Polycystic ovary syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.79914415; Fold-change: 0.098835265; Z-score: 0.542961465
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Obesity [ICD-11: 5B81]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Subcutaneous Adipose
The Specific Disease Obesity
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.67601806; Fold-change: 0.133982608; Z-score: 0.374252154
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pompe disease [ICD-11: 5C51.3]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Biceps muscle
The Specific Disease Pompe disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.03074452; Fold-change: 0.652127453; Z-score: 1.532010415
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Batten disease [ICD-11: 5C56.1]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Batten disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.92937804; Fold-change: 0.030537859; Z-score: 0.110119713
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 6
Click to Show/Hide the 2 Disease of This Class
Autism [ICD-11: 6A02]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Autism
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.177606044; Fold-change: -0.049143916; Z-score: -0.217712418
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Anxiety disorder [ICD-11: 6B00-6B0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Anxiety disorder
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.684674824; Fold-change: -0.004961368; Z-score: -0.015952233
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 8
Click to Show/Hide the 7 Disease of This Class
Parkinson disease [ICD-11: 8A00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Substantia nigra
The Specific Disease Parkinson disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.769728607; Fold-change: -0.035323157; Z-score: -0.11285505
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Huntington disease [ICD-11: 8A01]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Huntington disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.998664923; Fold-change: 0.03228522; Z-score: 0.169380183
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Alzheimer disease [ICD-11: 8A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Entorhinal cortex
The Specific Disease Alzheimer disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 3.54E-06; Fold-change: 0.18033988; Z-score: 0.641130722
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Seizure [ICD-11: 8A60-8A6Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Seizure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.571354224; Fold-change: 0.011334196; Z-score: 0.043421958
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Lateral sclerosis [ICD-11: 8B60.4]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.251657193; Fold-change: 0.393302035; Z-score: 0.95853088
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Cervical spinal cord
The Specific Disease Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.218138048; Fold-change: 0.143522258; Z-score: 0.330797415
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Muscular atrophy [ICD-11: 8C70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Muscle
The Specific Disease Muscular atrophy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.05684851; Fold-change: 0.123851789; Z-score: 0.310650266
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Myopathy [ICD-11: 8C70.6]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Muscle
The Specific Disease Myopathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.734562509; Fold-change: -0.03418859; Z-score: -0.262871323
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
References
Ref 1 Immunomodulatory antibody-drug conjugates; 2022-07-21.
Ref 2 Phase 1, open-label study of MEDI-547 in patients with relapsed or refractory solid tumors. Invest New Drugs. 2013 Feb;31(1):77-84.
Ref 3 Introduction to basic information on ADC drug 1C1-mcMMAF
Ref 4 Conjugated compounds comprising cysteine engineered antibodies.
Ref 5 A phase 1 study evaluating the safety, pharmacology and preliminary activity of MM-310 in patients with solid tumors. Journal of Clinical Oncology 2018 36:15_suppl, TPS2604-TPS2604.
Ref 6 ATRC-301: a novel EphA2-targeting ADC binding a unique epitope
Ref 7 Syntab therapeutics biotechnology company product pipeline
Ref 8 Introduction to basic information on ADC drug SAB-Y19.
Ref 9 Introduction to basic information on ADC drug SAB-Y20.