Antibody Information
General Information of This Antibody (ID: ANTI0MZYNR)
| Antibody Name | Anti-hCLDN6 antibody Ab1 |
|||||
|---|---|---|---|---|---|---|
| Organization | ASTELLAS PHARMA INC. |
|||||
| Synonyms |
Ab1
Click to Show/Hide
|
|||||
| Antibody Type | Monoclonal antibody (mAb) |
|||||
| Antibody Subtype | Humanized lgG1 |
|||||
| Antigen Name | Claudin-6 (CLDN6) |
Antigen Info | ||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Sequence |
NQKFKGRFTLSVDKSKSTAYLQMNSLRAEDTAVYYCARDYGFVLDYWGRGTLVTVSSAST
KGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLY SLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSV FLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTY RVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTK NOQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQ GNVFSCSVMHEALHNHYTQKSLSLSPGK Click to Show/Hide
|
|||||
| Light Chain Sequence |
DIQLTQSPSSLSASVGDRVTITCSASSSVSYLHWFQQKPGKAPKLLVYSTSNLPSGVPSR
FSGSGSGTDYTLTISSLOPEDFATYYCQQRSIYPPWTFGQGTKLEIKRTVAAPSVFIFPP SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT LSKADYEKHKVYACEVTHOQGLSSPVTKSFNRGEC Click to Show/Hide
|
|||||
The Activity Data of This Antibody
| Antibody Activity Information 1 | [1] | |||||
|
Half Maximal Effective Concentration (EC50)
|
800≈1000
|
ng/mL
|
Human gastric cancer cell lineNUGC-3 (JCRB cell bank) expressing CLDN7 | CVCL_1612 | ||
|---|---|---|---|---|---|---|
| Antigen Expression | Positive hCLDN6 expression (hCLDN6+++/++) | |||||
| Antibody Function | anti-hCLDN6 antibody Ab1 bound to Human gastric cancer cell lineNUGC-3 (JCRB cell bank) expressing CLDN6 | |||||
| Antibody Antigen Binding Assay | Human gastric cancer cell line NUGC-3 (JCRB cell bank) expressing CLDN6 were suspended with PBS containing 5% FBS so as to have a concentration of 1x10°Cells/mL. Thesuspension was seeded (added) in the wells of a 96-well V-bottom microplate at a rate of 100 uL/well. After cen-trifugation, the supernatant was removed. AbM: antibodycomprising a heavy chain, aCLDN6-VH-CH,-CH,-CH, and a light chain, aCLDN6-VL-CL, disclosed in Inter-national Publication No. WO2022/058298. Ab0O, Ab] andAb2 were suspended with 5% FBS-containing PBS such thatthe concentrations fall in the range of 1 ng/mL to 25 ng/mL (12 dilution series were prepared by serial dilution at a2.5-fold dilution rate from 25 ug/mL to 1 ng/mL). Thesuspensions were added at a rate of 100 wL/well and allowedto stand still at 4°C. for one hour. PE-F (ab'), Goat anti-human IgG (JACKSON, #109-006-098 were diluted 100-fold with 5% FBS-containing PBS. The diluted solution was used to dilute Zombie NIR Fixable Viability Kit (Biolegend,#423106) 200-fold to prepare a secondary-antibody solu-tion. Washing was carried out twice with 5% FBS-contain-ing PBS and the secondary-antibody solution prepared wasadded at a rate of 100 wL/well and allowed to stand still at4°C. for one hour. After washing was carried out twice with5% FBS-containing PBS, resuspension was carried out with5% FBS-containing PBS. Detection was carried out. A histogram of PE (phycoerythrin) fluorescence intensity of viable cell frac-tions was prepared and geometric mean fluorescence inten-sity (gMFI) was calculated. | |||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
US20250025567A1 ExL1A1 [Investigative]
Discovered Using Cell Line-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth lnhibition value (TGl) | > 50% | Positive CLDN6 expression (CLDN6+++/++) | ||
| Method Description |
ExL1A1 was tested in SCID mice that subcutaneously transplanted NUGC33, 3 mg/kg was administeredthrough the tail vein of the tumor-bearing mice.
|
||||
| In Vivo Model | NUGC-3 cells SCID mice model | ||||
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | The ADC concentration required to produce 10,000 pg/mL TNF-alpha was evaluated. |
100- 1000 nM
|
Positive CLDN6 expression (CLDN6+++/++) | ||
| Method Description |
ExL1A1 was tested in co-culture system consisting of Human peripheral blood mononuclear cells (PBMCs) and NUGC33 cells, with the concentration range of 5.5 uM to 0.97 uM,TNF-a and INF-y productions were measured.
|
||||
| In Vitro Model | Normal; Gastric adenocarcinoma | PBMC cells; NUGC3 cells | .;CVCL_1612 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | The ADC concentration required to produce 10,000 pg/mL INF-Gamma was evaluated. |
10- 100 nM
|
Positive CLDN6 expression (CLDN6+++/++) | ||
| Method Description |
ExL1A1 was tested in co-culture system consisting of Human peripheral blood mononuclear cells (PBMCs) and NUGC33 cells, with the concentration range of 5.5 uM to 0.97 uM,TNF-a and INF-y productions were measured.
|
||||
| In Vitro Model | Normal; Gastric adenocarcinoma | PBMC cells; NUGC3 cells | .;CVCL_1612 | ||
US20250025567A1 ExL5A1 [Investigative]
Discovered Using Cell Line-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth lnhibition value (TGl) | > 50% | Positive CLDN6 expression (CLDN6+++/++) | ||
| Method Description |
ExL5A1 was tested in SCID mice that subcutaneously transplanted NUGC33, 3 mg/kg was administeredthrough the tail vein of the tumor-bearing mice.
|
||||
| In Vivo Model | NUGC-3 cells SCID mice model | ||||
US20250025567A1 ExL7A1 [Investigative]
Discovered Using Cell Line-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth lnhibition value (TGl) | > 50% | Positive CLDN6 expression (CLDN6+++/++) | ||
| Method Description |
ExL7A1 was tested in SCID mice that subcutaneously transplanted NUGC33, 3 mg/kg was administeredthrough the tail vein of the tumor-bearing mice.
|
||||
| In Vivo Model | NUGC-3 cells SCID mice model | ||||
