General Information of This Antibody (ID: ANTI0LXSXV)
Antibody Name
B62-H3L3
Organization
HANGZHOU ZHONGMEIHUADONG PHARMACEUTICAL CO. LTD. | SANYOU BIOPHARMACEUTICALS CO. LTD.
Synonyms
B62-H3L3
   Click to Show/Hide
Antibody Type
Monoclonal antibody (mAb)
Antibody Subtype
Humanized lgG
Antigen Name
Inactive tyrosine-protein kinase transmembrane receptor ROR1 (ROR1)
 Antigen Info 
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYVMSWVRQAPGKGLEYVATINSNGGNTYY
ADSVKGRFTISRDNSKNTLYLQMGSLRAEDTAMYYCARDSLGLRRRDYAMDYWGQGTTVT
VSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVL
QSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEL
LGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREE
QYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPS
RDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDK
SRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    Click to Show/Hide
Heavy Chain Varible Domain
EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYVMSWVRQAPGKGLEYVATINSNGGNTYY
ADSVKGRFTISRDNSKNTLYLQMGSLRAEDTAMYYCARDSLGLRRRDYAMDYWGQGTTVT
VSS
    Click to Show/Hide
Heavy Chain CDR 1
GFTFSSYVMS
    Click to Show/Hide
Heavy Chain CDR 2
TINSNGGNTY
    Click to Show/Hide
Heavy Chain CDR 3
DSLGLRRRDYAMDY
    Click to Show/Hide
Light Chain Sequence
DIQMTQSPSSLSASVGDRVTITCVTSIDIDDDVNWYQQKPGKAPKLLISAGNTLRPGVPS
RFSGSGSGTDFTFTISSLQPEDIATYYCLQSDNLPYTFGGGTKLEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
    Click to Show/Hide
Light Chain Varible Domain
DIQMTQSPSSLSASVGDRVTITCVTSIDIDDDVNWYQQKPGKAPKLLISAGNTLRPGVPS
RFSGSGSGTDFTFTISSLQPEDIATYYCLQSDNLPYTFGGGTKLEIK
    Click to Show/Hide
Light Chain CDR 1
VTSIDIDDDVN
    Click to Show/Hide
Light Chain CDR 2
AGNTLRP
    Click to Show/Hide
Light Chain CDR 3
LQSDNLPYT
    Click to Show/Hide
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
B62-H3L3-MMAE [Investigative]
Discovered Using Cell Line-derived Xenograft Model
Click To Hide/Show 3 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth lnhibition value (TGl)
33.54%
Method Description
Cell line-derived xenograft models were established in nude mice by subcutaneous injection of 1x106 (HT-29) tumor cells, and treatment with 2mg/kg B62-H3L3-MMAE (BIW&#424) was initiated after tumor volume about 100mm3. Determined tumor volume after the experiment, measured at day 51.
In Vivo Model HT-29 xenograft model
Experiment 2 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth lnhibition value (TGl)
36.38%
Method Description
Cell line-derived xenograft models were established in female nude mice (Balb/C),by subcutaneous injection of 1x106 (A549) tumor cells,and treatment with 10mpk (mg/kg)B62-H3L3-MMAE (BIW&#423)was initiated after tumor volume about 100mm3. Determined tumor volume after the experiment, measured at day 48.
In Vivo Model A549 xenograft model
Experiment 3 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth lnhibition value (TGl)
73.87%
Method Description
Cell line-derived xenograft models were established in nude mice by subcutaneous injection of 1x106 (HT-29) tumor cells, and treatment with 10mg/kg B62-H3L3-MMAE (BIW&#424) was initiated after tumor volume about 100mm3. Determined tumor volume after the experiment, measured at day 51.
In Vivo Model HT-29 xenograft model
Revealed Based on the Cell Line Data
Click To Hide/Show 5 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Effective Concentration (EC50)
28.64 nM
High ROR1 expression (ROR1 +++)
Method Description
MDA-MB-468 cell line was plated at 2×105cell/mL, 90uL/well,12 hours later, ADCs (500, 158, 50, 15.8, 5, 1.58, 0.5, 0.158, 0.05nM) were added and incubated for 72h,then 10uL CCK8 (Bimake,B34304)was added to each well and a microplate reader was used for detection OD492.
In Vitro Model Breast adenocarcinoma MDA-MB-468 cells CVCL_0419
Experiment 2 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Effective Concentration (EC50)
50.14 nM
Method Description
Jeko-1 cell line was plated at 1×105cell/mL, 90uL/well,12 hours later, ADCs (500, 158, 50, 15.8, 5, 1.58, 0.5, 0.158, 0.05nM) were added and incubated for 72h,then 10uL CCK8 (Bimake,B34304)was added to each well and a microplate reader was used for detection OD492.
In Vitro Model Mantle cell lymphoma JeKo-1 cells CVCL_1865
Experiment 3 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Effective Concentration (EC50)
121.6 nM
Method Description
HT-29 cell line (1×104cell/mL,100uL/well) , the ADCs (2000, 500, 250, 125, 62.5, 31.25, 15.625, 7.813, 1.953nM) were added 12 hours later, and incubated for 96h, then 40uL/well MTS (Promega,G3580) was added to each well and a microplate reader was used for detection OD492.
In Vitro Model Colon adenocarcinoma HT-29 cells CVCL_0320
Experiment 4 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Effective Concentration (EC50)
128.6 nM
Method Description
NCI-H1944 cell line was plated at 1.2×105cell/mL, 90uL/well,12 hours later, ADCs (500, 158, 50, 15.8, 5, 1.58, 0.5, 0.158, 0.05nM) were added and incubated for 72h,then 10uL CCK8 (Bimake,B34304)was added to each well and a microplate reader was used for detection OD492.
In Vitro Model Lung adenocarcinoma NCI-H1944 cells CVCL_1508
Experiment 5 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Effective Concentration (EC50)
311.4 nM
Moderate ROR1 expression (ROR1++)
Method Description
A549 cell line at 1×104cell/mL,100uL/well, 12 hours later,ADCs (2000, 500, 250, 125, 62.5, 31.25, 15.625, 7.813, 1.953nM) were added and incubated for 72h, then 40uL/well MTS (Promega,G3580) was added to each well and a microplate reader was used for detection OD492.
In Vitro Model Lung adenocarcinoma A549 cells CVCL_0023
CO20240013452A2 ADC1 [Investigative]
Discovered Using Cell Line-derived Xenograft Model
Click To Hide/Show 3 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [2]
Efficacy Data Tumor Growth lnhibition value (TGl)
33.54%
Positive ROR1 expression (ROR1+++/++)
Method Description
Female Balb/C nude mice between 6-8 weeks of age were injected subcutaneously withHT-29 cells, when tumors reached appproximately 100 mm^3, animals were matched by tumor volume into treatment or controls groups. The test articles were given by tail vein at a dose (2 mg/kg) (BIW&#424).
In Vivo Model HT-29 xenograft model
Experiment 2 Reporting the Activity Date of This ADC [2]
Efficacy Data Tumor Growth lnhibition value (TGl)
36.38%
Positive ROR1 expression (ROR1+++/++)
Method Description
Female Balb/C nude mice between 6-8 weeks of age were injected subcutaneously with A549 cells, when tumors reached appproximately 100 mm^3, animals were matched by tumor volume into treatment or controls groups. The test articles were given by tail vein at a dose (10 mg/kg) (BIW&#423).
In Vivo Model A549 xenograft model
Experiment 3 Reporting the Activity Date of This ADC [2]
Efficacy Data Tumor Growth lnhibition value (TGl)
73.87%
Positive ROR1 expression (ROR1+++/++)
Method Description
Female Balb/C nude mice between 6-8 weeks of age were injected subcutaneously withHT-29 cells, when tumors reached appproximately 100 mm^3, animals were matched by tumor volume into treatment or controls groups. The test articles were given by tail vein at a dose (10 mg/kg) (BIW&#424).
In Vivo Model HT-29 xenograft model
Revealed Based on the Cell Line Data
Click To Hide/Show 5 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [2]
Efficacy Data Half Maximal Effective Concentration (EC50)
28.64 nM
Method Description
ADCs were tested in MDA-MB-468 cells, and were added at final working concentration at 500 nM, 158 nM, 50 nM, 15.8 nM, 5 nM, 1.58 nM, 0.5 nM, 0.158 nM, 0.05 Nm, incubated for 3 days.
In Vitro Model Breast adenocarcinoma MDA-MB-468 cells CVCL_0419
Experiment 2 Reporting the Activity Date of This ADC [2]
Efficacy Data Half Maximal Effective Concentration (EC50)
50.14 nM
Method Description
ADCs were tested in Jeko-1 cells, and were added at final working concentration at 500 nM, 158 nM, 50 nM, 15.8 nM, 5 nM, 1.58 nM, 0.5 nM, 0.158 nM, 0.05 Nm, incubated for 3 days.
In Vitro Model Mantle cell lymphoma JeKo-1 cells CVCL_1865
Experiment 3 Reporting the Activity Date of This ADC [2]
Efficacy Data Half Maximal Effective Concentration (EC50)
121.6 nM
Method Description
ADCs were tested in HT-29 cells, and were added at final working concentration at 2000 nM, 500 nM, 250 nM, 125 nM, 62.5 nM, 31.25 nM, 15.625 nM, 7.813 nM, 1.953 nM, incubated for 4 days.
In Vitro Model Colon adenocarcinoma HT-29 cells CVCL_0320
Experiment 4 Reporting the Activity Date of This ADC [2]
Efficacy Data Half Maximal Effective Concentration (EC50)
128.6 nM
Method Description
ADCs were tested in NCI-H1944 cells, and were added at final working concentration at 500 nM, 158 nM, 50 nM, 15.8 nM, 5 nM, 1.58 nM, 0.5 nM, 0.158 nM, 0.05 Nm, incubated for 3 days.
In Vitro Model Lung adenocarcinoma NCI-H1944 cells CVCL_1508
Experiment 5 Reporting the Activity Date of This ADC [2]
Efficacy Data Half Maximal Effective Concentration (EC50)
311.4 nM
Method Description
ADCs were tested in A549 cells, and were added at final working concentration at 2000 nM, 500 nM, 250 nM, 125 nM, 62.5 nM, 31.25 nM, 15.625 nM, 7.813 nM, 1.953 nM, incubated for 3 days.
In Vitro Model Lung adenocarcinoma A549 cells CVCL_0023
KR1020250008730A ADC1 [Investigative]
Discovered Using Cell Line-derived Xenograft Model
Click To Hide/Show 3 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [3]
Efficacy Data Tumor Growth lnhibition value (TGl)
33.54%
Method Description
A xenograft model derived from cell lines was established by unilateral subcutaneous injection of 1×10^6 HT-29 cells into female Balb/C nude mice. When the tumor volume reached approximately 100 mm^3, B62-H3L3-MMAE was administered at a dose of 2 mg/kg. The treatment was given twice a week for 4 weeks. The tumor inhibition rate was calculated at the end of the experiment.

   Click to Show/Hide
In Vivo Model HT-29-xenograft model
Experiment 2 Reporting the Activity Date of This ADC [3]
Efficacy Data Tumor Growth lnhibition value (TGl)
36.38%
Method Description
A xenograft model derived from cell lines was established by unilateral subcutaneous injection of 1×10^6 A549 cells into female Balb/C nude mice. When the tumor volume reached approximately 100 mm^3, B62-H3L3-MMAE was administered at a dose of 10 mg/kg. The treatment was given twice a week for 3 weeks. The tumor inhibition rate was calculated at the end of the experiment.

   Click to Show/Hide
In Vivo Model A549-xenograft model
Experiment 3 Reporting the Activity Date of This ADC [3]
Efficacy Data Tumor Growth lnhibition value (TGl)
73.87%
Method Description
A xenograft model derived from cell lines was established by unilateral subcutaneous injection of 1×10^6 HT-29 cells into female Balb/C nude mice. When the tumor volume reached approximately 100 mm^3, B62-H3L3-MMAE was administered at a dose of 10 mg/kg. The treatment was given twice a week for 4 weeks. The tumor inhibition rate was calculated at the end of the experiment.

   Click to Show/Hide
In Vivo Model HT-29-xenograft model
Revealed Based on the Cell Line Data
Click To Hide/Show 3 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [3]
Efficacy Data Half Maximal Effective Concentration (EC52)
128.6 nM
Method Description
NCI-H1944 cells were added with ADC samples, and the drug concentration gradient was diluted to 500, 158, 50, 15.8, 5, 1.58, 0.5, 0.158, and 0.05 nM. The cells were cultured at 37°C with 5% CO2 for 72 hours. Then, 10 uL of LCK8 (Bimake, B34304) was added to each well, and the cells were incubated at 37°C for 1 hour. The data were read at OD450 using a microplate reader.

   Click to Show/Hide
In Vitro Model Lung adenocarcinoma NCI-H1944 cells CVCL_1508
Experiment 2 Reporting the Activity Date of This ADC [3]
Efficacy Data Half Maximal Effective Concentration (EC51)
28.64 nM
Method Description
MDA-MB-468 cells were added with ADC samples, and the drug concentration gradient was diluted to 500, 158, 50, 15.8, 5, 1.58, 0.5, 0.158, and 0.05 nM. The cells were cultured at 37°C with 5% CO2 for 72 hours. Then, 10 uL of LCK8 (Bimake, B34304) was added to each well, and the cells were incubated at 37°C for 1 hour. The data were read at OD450 using a microplate reader.

   Click to Show/Hide
In Vitro Model Breast adenocarcinoma MDA-MB-468 cells CVCL_0419
Experiment 3 Reporting the Activity Date of This ADC [3]
Efficacy Data Half Maximal Effective Concentration (EC50)
50.14 nM
Method Description
Jeko-1 cells were co-cultured with ADC samples, and the drug concentration gradient was diluted to 500, 158, 50, 15.8, 5, 1.58, 0.5, 0.158, and 0.05 nM. The cells were cultured at 37°C with 5% CO2 for 72 hours. Then, 10 uL of LCK8 (Bimake, B34304) was added to each well, and the reaction was incubated at 37°C for 1 hour. The data were read at OD450 using a microplate reader.

   Click to Show/Hide
In Vitro Model Mantle cell lymphoma JeKo-1 cells CVCL_1865
References
Ref 1 Binding molecules targeting ROR1 and uses thereof
Ref 2 Binding molecule directed to ror1 and its use
Ref 3 Ror1-targeted binding molecules and their Applications