General Information of This Antibody (ID: ANTI0LULWQ)
Antibody Name
Sigvotatug
Organization
Seagen Inc.
Synonyms
Sigvotatug
   Click to Show/Hide
Antibody Type
Monoclonal antibody (mAb)
Antigen Name
Integrin beta-6 (ITGB6)
 Antigen Info 
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence
QFQLVQSGAEVKKPGASVKVSCKASGYSFTDYNVNWVRQAPGQGLEWIGVINPKYGTTRY
NQKFKGRATLTVDKSTSTAYMELSSLRSEDTAVYYCTRGLNAWDYWGQGTLVTVSS
    Click to Show/Hide
Light Chain Sequence
DIQMTQSPSSLSASVGDRVTITCGASENIYGALNWYQQKPGKAPKLLIYGATNLEDGVPS
RFSGSGSGRDYTFTISSLQPEDIATYYCQNVLTTPYTFGQGTKLEIK
    Click to Show/Hide
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
Sigvotatug vedotin [Phase 3]
Identified from the Human Clinical Data
Click To Hide/Show 4 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Objective Response Rate (ORR)
19.5
32.5 %
Patients Enrolled
Eligible participants must have metastatic/unresectable solid tumors (e.g., NSCLC, HNSCC, HER2-negative breast cancer) and meet cohort-specific requirements: Part A (refractory to standard therapies), Part B (prior platinum/PD-1 therapy), Part C/D (treatment-na&iuml;ve for advanced disease where applicable). Key exclusions: active CNS metastases (exceptions for stable, treated cases), prior MMAE/integrin beta-6 therapy, Grade &ge;2 neuropathy (Grade &ge;1 for cisplatin/carboplatin cohorts), unresolved ILD/pneumonitis, or DLCO <50%.

   Click to Show/Hide
Administration Dosage
Eligible pts had no therapeutic options (Part A) or had received platinum-based and anti-PD- (L)1 therapy unless contraindicated (Part B) and were dosed with the SV expansion regimens on D1 and D8 in a 21-day cycle (2Q3W; 1.2/1.25 mg/kg total body weight [TBW]) or D1 and D15 in a 28-day cycle (2Q4W; 1.5 mg/kg TBW, 1.8 mg/kg adjusted ideal body weight [AiBW]).

   Click to Show/Hide
Related Clinical Trial
NCT Number NCT04389632  Clinical Status PHASE1
Clinical Description
A Phase 1 Study of SGN-B6A in Advanced Solid Tumors
Primary Endpoint
Safety endpoints include the number of participants experiencing adverse events (AEs), laboratory abnormalities, and dose-limiting toxicities (DLTs), assessed up to 3 years, with AE monitoring extended to 90 days post-pembrolizumab for relevant cohorts.
Other Endpoint
Efficacy measures consist of confirmed objective response rate (ORR), duration of response (DOR), progression-free survival (PFS), and overall survival (OS), all per RECIST v1.1. Pharmacokinetic (PK) parameters-AUC, Cmax, Tmax, Ctrough, and t1/2-as well as antidrug antibodies (ADAs), will be evaluated up to 3 years post-treatment.
Experiment 2 Reporting the Activity Date of This ADC [2]
Patients Enrolled
Eligible patients must have specific advanced solid tumors (NSCLC, HNSCC, ESCC, GAC/EAC/GEJ) refractory to standard therapies, adequate organ function, and ECOG 0-1. Key exclusions include recent malignancies, pulmonary complications &ge;Grade 3, active CNS metastases, prior MMAE treatment, and recent anticancer therapies/herbals with defined washout periods.

   Click to Show/Hide
Administration Dosage
sigvotatug vedotin monotherapy 1.8 mg/kg adjusted ideal body weight intravenous administration on Days 1 and 15 of a 28-day cycle.
Related Clinical Trial
NCT Number NCT06549816  Clinical Status PHASE1
Clinical Description
An Open-label, Phase 1 Study to Investigate the Safety and Pharmacokinetics of SGN-B6A in Chinese Subjects With Advanced Solid Tumors
Primary Endpoint
Primary endpoints include AE assessment over 3 years, lab abnormalities tracking within 30-37 days post-treatment, and DLT monitoring during the initial 28-day period following sigvotatug vedotin administration.
Other Endpoint
Pharmacokinetic parameters (AUC, Cmax, Tmax, t1/2, Ctrough) for both ac-MMAE and MMAE will be evaluated following single and multiple doses of SGN-B6A across two treatment cycles (28 days each), along with antidrug antibody detection up to 37 days post-treatment.
Experiment 3 Reporting the Activity Date of This ADC [3]
Patients Enrolled
Eligible patients must have unresectable/metastatic non-squamous NSCLC (Stage IIIB-IV per AJCC v8), measurable disease (RECIST v1.1), and progression after platinum/PD- (L)1 therapy (or AGA-targeted therapy if applicable). Key exclusions include life expectancy <3 months, prior taxanes/MMAE exposure in metastatic setting, unresolved Grade &ge;2 neuropathy, uncontrolled ILD (steroid-dependent or DLCO <50%), active CNS metastases (unless stable for &ge;4 weeks post-treatment with steroids &le;10mg/day), and recent anticancer therapy (<21 days before C1D1).

   Click to Show/Hide
Administration Dosage
Given into the vein (IV; intravenously) on Day 1 and 15 of a 28-day cycle
Related Clinical Trial
NCT Number NCT06012435  Clinical Status PHASE3
Clinical Description
A Randomized, Phase 3, Open-label Study to Evaluate Sigvotatug Vedotin Compared With Docetaxel in Adult Participants With Previously Treated Non-small Cell Lung Cancer (Be6A Lung-01)
Primary Endpoint
The primary efficacy endpoints include OS (time from randomization to death) and PFS per RECIST v1.1 (time to disease progression or death) comparing sigvotatug vedotin versus docetaxel in both the overall population and IB6-high subgroup over 5 years.
Other Endpoint
Secondary endpoints include ORR per RECIST v1.1 (confirmed CR/PR rates by BICR and investigator assessment), DOR (time from response to progression/death), AEs within 30 days post-treatment, and quality-of-life metrics (EORTC QLQ-C30 and QLQ-LC13) assessing global health status, physical/role functioning, and symptom scales (dyspnea, cough, chest pain), along with TTD for key PROs over 5 years of follow-up.

   Click to Show/Hide
Experiment 4 Reporting the Activity Date of This ADC [4]
Patients Enrolled
Patients with metastatic or unresectable solid tumors.
Administration Dosage
30 patients in Q1W (0.80, 1.00, and 1.20 mg/kg); 18 patients in 2Q3W (1.20 or 1.25 mg/kg).
Related Clinical Trial
NCT Number NCT04389632  Clinical Status Phase 1/2
Clinical Description
A phase 1 study of SGN-B6A in advanced solid tumors.
References
Ref 1 A Study of SGN-B6A in Advanced Solid Tumors
Ref 2 A Study of SGN-B6A in Chinese Participants With Advanced Solid Tumors
Ref 3 A Study of Sigvotatug Vedotin Versus Docetaxel in Previously Treated Non-small Cell Lung Cancer (Be6A Lung-01).
Ref 4 Phase 1 dose escalation study of MGC018, an anti-B7-H3 antibody-drug conjugate (ADC), in patients with advanced solid tumors. J Clin Oncol. 2021 39:15_suppl, 2631-2631.