General Information of This Antibody (ID: ANTI0LNEPP)
Antibody Name
5B
Organization
Laboratories Pierre Fabre
Synonyms
5B
   Click to Show/Hide
Antibody Type
Monoclonal antibody (mAb)
Antibody Subtype
Humanized lgG1
Antigen Name
V-type immunoglobulin domain-containing suppressor of T-cell activation (VSIR)
 Antigen Info 
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Varible Domain
MGWSCIFFLVATATGVHSOVOLOOSGAELVRPGVSVKISCKGSGYTFTDYGMHWVKQSHA
KSLEWIGHDTYYGDATYNOKFKGKATMTVDKSSSTAYMELARLTSEDSAIYYCARRAGNA
MDYWGOGTSVTVSS
    Click to Show/Hide
Light Chain Varible Domain
MKSOTOVFVFLLLCVSGAHGNIVMTOTPKFLLVSAGDRVTITCKASOSVSNDVAWYQOKP
GOSPKLLIYYASNRYTGVPDRFTGSGYGTDFTFTISTVQAEDLAVYFCOODYSSPRTFGG
GTKLEIK
    Click to Show/Hide
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
CN114230664B 5B: DBM- (C6)-MMAF [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 3 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50) < 0.001 nM High C10orf54 expression (C10orf54 +++)
Method Description
175A: DBM- (C6)-MMAF was tested in P31/FUJ,100-300nm,3days
In Vitro Model Acute myeloid leukemia, Childhood acute myeloid leukemia P31/FUJ cells CVCL_1632
Experiment 2 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
0.16 nM
High C10orf54 expression (C10orf54 +++)
Method Description
175A: DBM- (C6)-MMAF was tested in OCI/AML3,100-300nm,3days
In Vitro Model Adult acute myelomonocytic leukemia, Acute myelomonocytic leukemia OCI/AML3 cells CVCL_1844
Experiment 3 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
7.83 nM
High C10orf54 expression (C10orf54 +++)
Method Description
175A: DBM- (C6)-MMAF was tested in PL21,100-300nm,3days
In Vitro Model Acute promyelocytic leukemia PL21 cells CVCL_2161
References
Ref 1 Anti-C10orf54 antibodies and uses thereof