Antibody Information
General Information of This Antibody
| Antibody ID | ANTI0KVGMY |
|||||
|---|---|---|---|---|---|---|
| Antibody Name | Intetumumab |
|||||
| Organization | ImmunoGen, Inc.; Centocor, Inc.; Johnson & Johnson |
|||||
| Synonyms |
Intetumumab
Click to Show/Hide
|
|||||
| Antibody Type | Monoclonal antibody (mAb) |
|||||
| Antigen Name | Integrin alpha-V (ITGAV) |
Antigen Info | ||||
| DrugBank ID | ||||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Sequence |
QVQLVESGGGVVQPGRSRRLSCAASGFTFSRYTMHWVRQAPGKGLEWVAVISFDGSNKYY
VDSVKGRFTISRDNSENTLYLQVNILRAEDTAVYYCAREARGSYAFDIWGQGTMVTVSS Click to Show/Hide
|
|||||
| Light Chain Sequence |
EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPA
RFSGSGSGTDFTLTISSLEPEDFAVYYCQQRSNWPPFTFGPGTKVDIK Click to Show/Hide
|
|||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
IMGN388 [Phase 1 (discontinued)]
Identified from the Human Clinical Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Related Clinical Trial | |||||
| NCT Number | NCT00721669 | Clinical Status | Phase 1 | ||
| Clinical Description |
A phase 1 dose-escalation study of IMGN388 in patients with solid tumors.
|
||||
| Primary Endpoint |
Five patients (breast,prostate,neuroendocrine,and 2 NSCLC) treated at doses 45 mg/m2 have acheived stable disease for 4 cycles.
|
||||
| Experiment 2 Reporting the Activity Date of This ADC | [2] | ||||
| Patients Enrolled |
Advanced solid tumors.
|
||||
| Administration Dosage |
Doses ranging from 5 to 80 mg/m2, every 3 weeks, IV.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT00721669 | Clinical Status | Phase 1 | ||
| Clinical Description |
A phase 1 dose-escalation study of IMGN388 in patients with solid tumors.
|
||||
| Primary Endpoint |
No evidence of activity was observed at the lowest doses (45 mg/m2) evaluated.
|
||||
| Other Endpoint |
No evidence of human anti-human antibody formation (data available for doses up to 60 mg/m2.
|
||||
| Experiment 3 Reporting the Activity Date of This ADC | [3] | ||||
| Patients Enrolled |
Eligible patients must be ≥18 years with histologically confirmed metastatic/unresectable alphav integrin-positive tumors (melanoma, breast, lung, or ovarian cancer in expansion phase, confirmed by IHC) and measurable disease. Key requirements include ECOG ≤2, adequate organ function (ANC ≥1500/mm <sup>3</sup>, platelets ≥100K/mm <sup>3</sup>, hepatic/renal parameters ≤1.5-2.5×ULN), and contraception use. Exclusions cover active CNS metastases, grade ≥1 residual toxicity, recent anticancer therapy (<4 weeks), uncontrolled infections, NYHA class III/IV cardiac disease, HIV/Hepatitis coinfection, pregnancy, or conditions compromising safety per investigator judgment. Patients will undergo scheduled safety and survival follow-ups post-treatment.
Click to Show/Hide
|
||||
| Administration Dosage |
26 patients received a total of 52 cycles of IMGN388 at doses ranging from 5 to 80 mg/m2.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT00721669 | Clinical Status | PHASE1 | ||
| Clinical Description |
A Phase I Dose-Escalation Study of IMGN388 in Patients With Solid Tumors
|
||||
| Primary Endpoint |
The study evaluates safety and pharmacokinetics of the investigational agent during the treatment period, focusing on identifying adverse events, dose tolerability, and drug metabolism characteristics.
|
||||
| Other Endpoint |
Key secondary assessments include pharmacodynamic effects, immunogenicity potential, and tumor response evaluation (e.g., objective response rate, disease control) in patients with advanced solid tumors during the study timeframe.
|
||||
References