General Information of This Antibody (ID: ANTI0KVGMY)
Antibody Name
Intetumumab
Organization
ImmunoGen, Inc.; Centocor, Inc.; Johnson & Johnson
Synonyms
Intetumumab
   Click to Show/Hide
Antibody Type
Monoclonal antibody (mAb)
Antigen Name
Integrin alpha-V (ITGAV)
 Antigen Info 
DrugBank ID
DB12701
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence
QVQLVESGGGVVQPGRSRRLSCAASGFTFSRYTMHWVRQAPGKGLEWVAVISFDGSNKYY
VDSVKGRFTISRDNSENTLYLQVNILRAEDTAVYYCAREARGSYAFDIWGQGTMVTVSS
    Click to Show/Hide
Light Chain Sequence
EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPA
RFSGSGSGTDFTLTISSLEPEDFAVYYCQQRSNWPPFTFGPGTKVDIK
    Click to Show/Hide
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
IMGN388 [Phase 1 (discontinued)]
Identified from the Human Clinical Data
Click To Hide/Show 3 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Patients Enrolled
Eligible patients must be &ge;18 years with histologically confirmed metastatic/unresectable alphav integrin-positive tumors (melanoma, breast, lung, or ovarian cancer in expansion phase, confirmed by IHC) and measurable disease. Key requirements include ECOG &le;2, adequate organ function (ANC &ge;1500/mm <sup>3</sup>, platelets &ge;100K/mm <sup>3</sup>, hepatic/renal parameters &le;1.5-2.5&times;ULN), and contraception use. Exclusions cover active CNS metastases, grade &ge;1 residual toxicity, recent anticancer therapy (<4 weeks), uncontrolled infections, NYHA class III/IV cardiac disease, HIV/Hepatitis coinfection, pregnancy, or conditions compromising safety per investigator judgment. Patients will undergo scheduled safety and survival follow-ups post-treatment.

   Click to Show/Hide
Administration Dosage
26 patients received a total of 52 cycles of IMGN388 at doses ranging from 5 to 80 mg/m2.
Related Clinical Trial
NCT Number NCT00721669  Clinical Status PHASE1
Clinical Description
A Phase I Dose-Escalation Study of IMGN388 in Patients With Solid Tumors
Primary Endpoint
The study evaluates safety and pharmacokinetics of the investigational agent during the treatment period, focusing on identifying adverse events, dose tolerability, and drug metabolism characteristics.
Other Endpoint
Key secondary assessments include pharmacodynamic effects, immunogenicity potential, and tumor response evaluation (e.g., objective response rate, disease control) in patients with advanced solid tumors during the study timeframe.
Experiment 2 Reporting the Activity Date of This ADC [2]
Related Clinical Trial
NCT Number NCT00721669  Clinical Status Phase 1
Clinical Description
A phase 1 dose-escalation study of IMGN388 in patients with solid tumors.
Primary Endpoint
Five patients (breast,prostate,neuroendocrine,and 2 NSCLC) treated at doses 45 mg/m2 have acheived stable disease for 4 cycles.
Experiment 3 Reporting the Activity Date of This ADC [3]
Patients Enrolled
Advanced solid tumors.
Administration Dosage
Doses ranging from 5 to 80 mg/m2, every 3 weeks, IV.
Related Clinical Trial
NCT Number NCT00721669  Clinical Status Phase 1
Clinical Description
A phase 1 dose-escalation study of IMGN388 in patients with solid tumors.
Primary Endpoint
No evidence of activity was observed at the lowest doses (45 mg/m2) evaluated.
Other Endpoint
No evidence of human anti-human antibody formation (data available for doses up to 60 mg/m2.
References
Ref 1 A Phase I Dose-Escalation Study of IMGN388 in Patients With Solid Tumors
Ref 2 A phase I study of IMGN388, an antibody drug conjugate targeting av integrin, in patients with solid tumors.
Ref 3 A phase I dose-escalation study of IMGN388 in patients with solid tumors. Journal of Clinical Oncology 28, no. 15_suppl (May 20, 2010) 3058-3058.