Antibody Information
General Information of This Antibody
| Antibody ID | ANTI0KTVKA |
|||||
|---|---|---|---|---|---|---|
| Antibody Name | 25A3 |
|||||
| Organization | ICONIC THERAPEUTICS LLC |
|||||
| Synonyms |
25A3
Click to Show/Hide
|
|||||
| Antibody Type | Monoclonal antibody (mAb) |
|||||
| Antibody Subtype | Humanized lgG |
|||||
| Antigen Name | Tissue factor (F3) |
Antigen Info | ||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Varible Domain |
QVQLVQSGAEVKKPGASVKVSCKASGYTFDVYGISWVRQAPGQGLEWMGWIAPYSGNTNY
AQKLQGRVTMTTDTSTSTAYMELRSLRSDDTAVYYCARDAGTYSPFGYGMDVWGQGTTVT VSS Click to Show/Hide
|
|||||
| Heavy Chain CDR 1 |
GYTFDVYGIS
Click to Show/Hide
|
|||||
| Heavy Chain CDR 2 |
WIAPYSGNTNYAQKLQG
Click to Show/Hide
|
|||||
| Heavy Chain CDR 3 |
DAGTYSPFGYGMDV
Click to Show/Hide
|
|||||
| Light Chain Varible Domain |
DIQMTQSPSTLSASVGDRVTITCQASQSINNWLAWYQQKPGKAPKLLIYKAYNLESGVPS
RFSGSGSGTEFTLTISSLQPDDFATYYCQLFQSLPPFTFGGGTKVEIK Click to Show/Hide
|
|||||
| Light Chain CDR 1 |
QASQSINNWLA
Click to Show/Hide
|
|||||
| Light Chain CDR 2 |
KAYNLES
Click to Show/Hide
|
|||||
| Light Chain CDR 3 |
QLFQSLPPFT
Click to Show/Hide
|
|||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
EP4495597A2 25A3-MMAE [Investigative]
Discovered Using Cell Line-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth lnhibition value (TGl) |
66%
|
Positive TF expression (TF+++/++) | ||
| Method Description |
In the MDA-MB-231 xenograft model, the ADCs were administered on day 1 and 8 post-randomization at 2 mg/kg (qwk × 2, IV).
|
||||
| In Vivo Model | MDA-MB-231 xenograft model | ||||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth lnhibition value (TGl) |
100%
|
Positive TF expression (TF+++/++) | ||
| Method Description |
In the MDA-MB-231 xenograft model, the ADCs were administered on day 1 and 8 post-randomization at 4 mg/kg (qwk × 2, IV).
|
||||
| In Vivo Model | MDA-MB-231 xenograft model | ||||
| Experiment 3 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth lnhibition value (TGl) |
129%
|
Positive TF expression (TF+++/++) | ||
| Method Description |
HPAF-II pancreatic carcinoma epidermoid carcinoma cell lines were implanted subcutaneously in the flank of athymic nude mice. Animals were randomized and treated with drugs (2 mg/kg, qwk × 2, IV).
|
||||
| In Vivo Model | HPAF-II pancreatic carcinoma xenograft model | ||||
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.05 nM
|
Positive TF expression (TF+++/++) | ||
| Method Description |
The TF-specific ADCs were added to HPAF-II cells, with either a 72 h incubation or a 4 h incubation followed by removal of excess ADC and culture for another 70 h. HPAF-II cells were lysed in CTG assay reagent after treatment.
|
||||
| In Vitro Model | Pancreatic ductal adenocarcinoma | HPAF-II cells | CVCL_0313 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.09 nM
|
Positive TF expression (TF+++/++) | ||
| Method Description |
The TF-specific ADCs were added to A431 cells, with either a 72 h incubation or a 4 h incubation followed by removal of excess ADC and culture for another 68 h. A433cells were lysed in CTG assay reagent after treatment.
|
||||
| In Vitro Model | Skin squamous cell carcinoma | A431 cells | CVCL_0037 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.11 nM
|
Positive TF expression (TF+++/++) | ||
| Method Description |
The TF-specific ADCs were added to MDA-MB-231 cells, with either a 72 h incubation or a 4 h incubation followed by removal of excess ADC and culture for another 68 h. MDA-MB-231 cells were lysed in CTG assay reagent after treatment.
|
||||
| In Vitro Model | Breast adenocarcinoma | MDA-MB-231 cells | CVCL_0062 | ||