Antibody Information
General Information of This Antibody
| Antibody ID | ANTI0JYJCD |
|||||
|---|---|---|---|---|---|---|
| Antibody Name | 18G3 |
|||||
| Organization | Pfizer Inc. |
|||||
| Synonyms |
18G3
Click to Show/Hide
|
|||||
| Antigen Name | Interleukin-3 receptor subunit alpha (IL3RA) |
Antigen Info | ||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Sequence |
QVKLKESGPGLVAPAQSLSITCTVSGFSLTSGDISWIRQPPGKGLEWLGVIWSGGGTNYN
SRLMSRLSITKDNSRSQVFLKMNSLQTDDTAIYYCVRDWGNFYFDYWGQGTTLTVSSAST KGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLOSSGLY SLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDRTHTCPPCPAPELLGGPSV FLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPRELLQGSTY RVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTK NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG NVFSCSVMHEALHNHYTQKSLSLSPG Click to Show/Hide
|
|||||
| Heavy Chain Varible Domain |
QVKLKESGPGLVAPAQSLSITCTVSGFSLTSGDISWIRQPPGKGLEWLGVIWSGGGTNYN
SRIMSRLSITKDNSRSQVFLKMNSLQTDDTAIYYCVRDWGNFYFDYWGQGTTLTVSS Click to Show/Hide
|
|||||
| Heavy Chain Constant Domain 1 |
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLOSS
GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKV Click to Show/Hide
|
|||||
| Heavy Chain Constant Domain 2 |
APELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTK
PRELLQGSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK Click to Show/Hide
|
|||||
| Heavy Chain Constant Domain 3 |
GQPREPOVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDS
DGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG Click to Show/Hide
|
|||||
| Heavy Chain Hinge Region |
EPKSCDRTHTCPPCP
Click to Show/Hide
|
|||||
| Heavy Chain CDR 1 |
GFSLTSGDIS
Click to Show/Hide
|
|||||
| Heavy Chain CDR 2 |
VIWSGGGTNYNSRLMS
Click to Show/Hide
|
|||||
| Heavy Chain CDR 3 |
DWGNFYFDY
Click to Show/Hide
|
|||||
| Light Chain Sequence |
DIVMSQSPSSLAVSVGEKVTMSCKSSQSLLSSGTRKNYLAWYQQKPGQSPKLLIYWASTR
QSGVPDRFTGGGSGTDFTLTISSVQAEDLAVYYCSQSYNLYTFGGGTKLEIKRTVAAPSV FIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSL SSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Click to Show/Hide
|
|||||
| Light Chain Varible Domain |
DIVMSOSPSSLAVSVGEKVTMSCKSSOSLLSSGTRKNYLAWYQQKPGQSPKLLIYWASTR
OSGVPDRFTGGGSGTDFTLTISSVQAEDLAVYYCSQSYNLYTFGGGTKLEIK Click to Show/Hide
|
|||||
| Light Chain Constant Domain |
(R)TVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTE
QDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHOGLSSPVTKSENRGEC Click to Show/Hide
|
|||||
| Light Chain CDR 1 |
KSSOSLLSSGTRKNYLA
Click to Show/Hide
|
|||||
| Light Chain CDR 2 |
WASTROS
Click to Show/Hide
|
|||||
| Light Chain CDR 3 |
SQSYNLYTF
Click to Show/Hide
|
|||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
JP2024177330A5 18G3-iPr [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.05075 ng/mL
|
High CD123 expression (CD123+++) | ||
| Method Description |
MOLM13 cell line cells were incubated with ADC or control at the following doses: 100 ng/ml, 25 ng/ml, 6.25 ng/ml, 1.56 ng/ml, 0.39 ng/ml, 0.09 ng/ml, 0.024 ng/ml, 0.006 ng/ml, 0.002 ng/ml and 0.0004 ng/ml. for 96 hours. Cell viability was measured with CelltiterGlo (Promega, Madison, WI), and luminescence was determined using a Victor plate reader (Perkin Elmer, Waltham, MA). 50% inhibition value (IC50) calculations were generated using XLfit (IDBS, Boston, MA) 4 parameter curve fit.
Click to Show/Hide
|
||||
| In Vitro Model | Adult acute myeloid leukemia | MOLM-13 cells | CVCL_2119 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.125 ng/mL
|
High CD123 expression (CD123+++) | ||
| Method Description |
MV4-11 cell line cells were incubated with ADC or control at the following doses: 100 ng/ml, 25 ng/ml, 6.25 ng/ml, 1.56 ng/ml, 0.39 ng/ml, 0.09 ng/ml, 0.024 ng/ml, 0.006 ng/ml, 0.002 ng/ml and 0.0004 ng/ml. for 96 hours. Cell viability was measured with CelltiterGlo (Promega, Madison, WI), and luminescence was determined using a Victor plate reader (Perkin Elmer, Waltham, MA). 50% inhibition value (IC50) calculations were generated using XLfit (IDBS, Boston, MA) 4 parameter curve fit.
Click to Show/Hide
|
||||
| In Vitro Model | Childhood acute monocytic leukemia | MV4-11 cells | CVCL_0064 | ||
JP2024177330A5 18G3-CPI [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.25 ng/mL
|
High CD123 expression (CD123+++) | ||
| Method Description |
MOLM13 cell line cells were incubated with ADC or control at the following doses: 100 ng/ml, 25 ng/ml, 6.25 ng/ml, 1.56 ng/ml, 0.39 ng/ml, 0.09 ng/ml, 0.024 ng/ml, 0.006 ng/ml, 0.002 ng/ml and 0.0004 ng/ml. for 96 hours. Cell viability was measured with CelltiterGlo (Promega, Madison, WI), and luminescence was determined using a Victor plate reader (Perkin Elmer, Waltham, MA). 50% inhibition value (IC50) calculations were generated using XLfit (IDBS, Boston, MA) 4 parameter curve fit.
Click to Show/Hide
|
||||
| In Vitro Model | Adult acute myeloid leukemia | MOLM-13 cells | CVCL_2119 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.38 ng/mL
|
Moderate CD123 expression (CD123++) | ||
| Method Description |
Granta519 cell line cells were incubated with ADC or control at the following doses: 100 ng/ml, 25 ng/ml, 6.25 ng/ml, 1.56 ng/ml, 0.39 ng/ml, 0.09 ng/ml, 0.024 ng/ml, 0.006 ng/ml, 0.002 ng/ml and 0.0004 ng/ml. for 96 hours. Cell viability was measured with CelltiterGlo (Promega, Madison, WI), and luminescence was determined using a Victor plate reader (Perkin Elmer, Waltham, MA). 50% inhibition value (IC50) calculations were generated using XLfit (IDBS, Boston, MA) 4 parameter curve fit.
Click to Show/Hide
|
||||
| In Vitro Model | Mantle cell lymphoma | Granta519 cells | CVCL_1818 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.41 ng/mL
|
High CD123 expression (CD123+++) | ||
| Method Description |
MV4-11 cell line cells were incubated with ADC or control at the following doses: 100 ng/ml, 25 ng/ml, 6.25 ng/ml, 1.56 ng/ml, 0.39 ng/ml, 0.09 ng/ml, 0.024 ng/ml, 0.006 ng/ml, 0.002 ng/ml and 0.0004 ng/ml. for 96 hours. Cell viability was measured with CelltiterGlo (Promega, Madison, WI), and luminescence was determined using a Victor plate reader (Perkin Elmer, Waltham, MA). 50% inhibition value (IC50) calculations were generated using XLfit (IDBS, Boston, MA) 4 parameter curve fit.
Click to Show/Hide
|
||||
| In Vitro Model | Childhood acute monocytic leukemia | MV4-11 cells | CVCL_0064 | ||
| Experiment 4 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.69 ng/mL
|
Moderate CD123 expression (CD123++) | ||
| Method Description |
JVM3 cell line cells were incubated with ADC or control at the following doses: 100 ng/ml, 25 ng/ml, 6.25 ng/ml, 1.56 ng/ml, 0.39 ng/ml, 0.09 ng/ml, 0.024 ng/ml, 0.006 ng/ml, 0.002 ng/ml and 0.0004 ng/ml. for 96 hours. Cell viability was measured with CelltiterGlo (Promega, Madison, WI), and luminescence was determined using a Victor plate reader (Perkin Elmer, Waltham, MA). 50% inhibition value (IC50) calculations were generated using XLfit (IDBS, Boston, MA) 4 parameter curve fit.
Click to Show/Hide
|
||||
| In Vitro Model | B-cell prolymphocytic leukemia | JVM3 cells | CVCL_1320 | ||
| Experiment 5 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
2.65 ng/mL
|
Low CD123 expression (CD123+) | ||
| Method Description |
OCI-AML3 cell line cells were incubated with ADC or control at the following doses: 100 ng/ml, 25 ng/ml, 6.25 ng/ml, 1.56 ng/ml, 0.39 ng/ml, 0.09 ng/ml, 0.024 ng/ml, 0.006 ng/ml, 0.002 ng/ml and 0.0004 ng/ml. for 96 hours. Cell viability was measured with CelltiterGlo (Promega, Madison, WI), and luminescence was determined using a Victor plate reader (Perkin Elmer, Waltham, MA). 50% inhibition value (IC50) calculations were generated using XLfit (IDBS, Boston, MA) 4 parameter curve fit.
Click to Show/Hide
|
||||
| In Vitro Model | Adult acute myelomonocytic leukemia, Acute myelomonocytic leukemia | OCI-AML3 cells | CVCL_1844 | ||
| Experiment 6 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
63.92 ng/mL
|
Low CD123 expression (CD123+) | ||
| Method Description |
NB4 cell line cells were incubated with ADC or control at the following doses: 100 ng/ml, 25 ng/ml, 6.25 ng/ml, 1.56 ng/ml, 0.39 ng/ml, 0.09 ng/ml, 0.024 ng/ml, 0.006 ng/ml, 0.002 ng/ml and 0.0004 ng/ml. for 96 hours. Cell viability was measured with CelltiterGlo (Promega, Madison, WI), and luminescence was determined using a Victor plate reader (Perkin Elmer, Waltham, MA). 50% inhibition value (IC50) calculations were generated using XLfit (IDBS, Boston, MA) 4 parameter curve fit.
Click to Show/Hide
|
||||
| In Vitro Model | Acute promyelocytic leukemia, Acute promyelocytic leukemia with PML-RARA | NB4 cells | CVCL_0005 | ||
| Experiment 7 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) | > 84.4 ng/mL | Negative CD123 expression (CD123-) | ||
| Method Description |
HL60 cell line cells were incubated with ADC or control at the following doses: 100 ng/ml, 25 ng/ml, 6.25 ng/ml, 1.56 ng/ml, 0.39 ng/ml, 0.09 ng/ml, 0.024 ng/ml, 0.006 ng/ml, 0.002 ng/ml and 0.0004 ng/ml. for 96 hours. Cell viability was measured with CelltiterGlo (Promega, Madison, WI), and luminescence was determined using a Victor plate reader (Perkin Elmer, Waltham, MA). 50% inhibition value (IC50) calculations were generated using XLfit (IDBS, Boston, MA) 4 parameter curve fit.
Click to Show/Hide
|
||||
| In Vitro Model | Acute myeloblastic leukemia with maturation, Adult acute myeloid leukemia with maturation | HL60 cells | CVCL_0002 | ||
JP2024177330A5 18G3-CTI [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.26 ng/mL
|
Moderate CD123 expression (CD123++) | ||
| Method Description |
Granta519 cell line cells were incubated with ADC or control at the following doses: 100 ng/ml, 25 ng/ml, 6.25 ng/ml, 1.56 ng/ml, 0.39 ng/ml, 0.09 ng/ml, 0.024 ng/ml, 0.006 ng/ml, 0.002 ng/ml and 0.0004 ng/ml. for 96 hours. Cell viability was measured with CelltiterGlo (Promega, Madison, WI), and luminescence was determined using a Victor plate reader (Perkin Elmer, Waltham, MA). 50% inhibition value (IC50) calculations were generated using XLfit (IDBS, Boston, MA) 4 parameter curve fit.
Click to Show/Hide
|
||||
| In Vitro Model | Mantle cell lymphoma | Granta519 cells | CVCL_1818 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.33 ng/mL
|
High CD123 expression (CD123+++) | ||
| Method Description |
MOLM13 cell line cells were incubated with ADC or control at the following doses: 100 ng/ml, 25 ng/ml, 6.25 ng/ml, 1.56 ng/ml, 0.39 ng/ml, 0.09 ng/ml, 0.024 ng/ml, 0.006 ng/ml, 0.002 ng/ml and 0.0004 ng/ml. for 96 hours. Cell viability was measured with CelltiterGlo (Promega, Madison, WI), and luminescence was determined using a Victor plate reader (Perkin Elmer, Waltham, MA). 50% inhibition value (IC50) calculations were generated using XLfit (IDBS, Boston, MA) 4 parameter curve fit.
Click to Show/Hide
|
||||
| In Vitro Model | Adult acute myeloid leukemia | MOLM-13 cells | CVCL_2119 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.51 ng/mL
|
High CD123 expression (CD123+++) | ||
| Method Description |
MV4-11 cell line cells were incubated with ADC or control at the following doses: 100 ng/ml, 25 ng/ml, 6.25 ng/ml, 1.56 ng/ml, 0.39 ng/ml, 0.09 ng/ml, 0.024 ng/ml, 0.006 ng/ml, 0.002 ng/ml and 0.0004 ng/ml. for 96 hours. Cell viability was measured with CelltiterGlo (Promega, Madison, WI), and luminescence was determined using a Victor plate reader (Perkin Elmer, Waltham, MA). 50% inhibition value (IC50) calculations were generated using XLfit (IDBS, Boston, MA) 4 parameter curve fit.
Click to Show/Hide
|
||||
| In Vitro Model | Childhood acute monocytic leukemia | MV4-11 cells | CVCL_0064 | ||
| Experiment 4 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
1.3 ng/mL
|
Moderate CD123 expression (CD123++) | ||
| Method Description |
JVM3 cell line cells were incubated with ADC or control at the following doses: 100 ng/ml, 25 ng/ml, 6.25 ng/ml, 1.56 ng/ml, 0.39 ng/ml, 0.09 ng/ml, 0.024 ng/ml, 0.006 ng/ml, 0.002 ng/ml and 0.0004 ng/ml. for 96 hours. Cell viability was measured with CelltiterGlo (Promega, Madison, WI), and luminescence was determined using a Victor plate reader (Perkin Elmer, Waltham, MA). 50% inhibition value (IC50) calculations were generated using XLfit (IDBS, Boston, MA) 4 parameter curve fit.
Click to Show/Hide
|
||||
| In Vitro Model | B-cell prolymphocytic leukemia | JVM3 cells | CVCL_1320 | ||
| Experiment 5 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
2.58 ng/mL
|
Low CD123 expression (CD123+) | ||
| Method Description |
OCI-AML3 cell line cells were incubated with ADC or control at the following doses: 100 ng/ml, 25 ng/ml, 6.25 ng/ml, 1.56 ng/ml, 0.39 ng/ml, 0.09 ng/ml, 0.024 ng/ml, 0.006 ng/ml, 0.002 ng/ml and 0.0004 ng/ml. for 96 hours. Cell viability was measured with CelltiterGlo (Promega, Madison, WI), and luminescence was determined using a Victor plate reader (Perkin Elmer, Waltham, MA). 50% inhibition value (IC50) calculations were generated using XLfit (IDBS, Boston, MA) 4 parameter curve fit.
Click to Show/Hide
|
||||
| In Vitro Model | Adult acute myelomonocytic leukemia, Acute myelomonocytic leukemia | OCI-AML3 cells | CVCL_1844 | ||
| Experiment 6 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
38.6 ng/mL
|
Low CD123 expression (CD123+) | ||
| Method Description |
NB4 cell line cells were incubated with ADC or control at the following doses: 100 ng/ml, 25 ng/ml, 6.25 ng/ml, 1.56 ng/ml, 0.39 ng/ml, 0.09 ng/ml, 0.024 ng/ml, 0.006 ng/ml, 0.002 ng/ml and 0.0004 ng/ml. for 96 hours. Cell viability was measured with CelltiterGlo (Promega, Madison, WI), and luminescence was determined using a Victor plate reader (Perkin Elmer, Waltham, MA). 50% inhibition value (IC50) calculations were generated using XLfit (IDBS, Boston, MA) 4 parameter curve fit.
Click to Show/Hide
|
||||
| In Vitro Model | Acute promyelocytic leukemia, Acute promyelocytic leukemia with PML-RARA | NB4 cells | CVCL_0005 | ||
| Experiment 7 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) | > 100 ng/mL | Negative CD123 expression (CD123-) | ||
| Method Description |
HL60 cell line cells were incubated with ADC or control at the following doses: 100 ng/ml, 25 ng/ml, 6.25 ng/ml, 1.56 ng/ml, 0.39 ng/ml, 0.09 ng/ml, 0.024 ng/ml, 0.006 ng/ml, 0.002 ng/ml and 0.0004 ng/ml. for 96 hours. Cell viability was measured with CelltiterGlo (Promega, Madison, WI), and luminescence was determined using a Victor plate reader (Perkin Elmer, Waltham, MA). 50% inhibition value (IC50) calculations were generated using XLfit (IDBS, Boston, MA) 4 parameter curve fit.
Click to Show/Hide
|
||||
| In Vitro Model | Acute myeloblastic leukemia with maturation, Adult acute myeloid leukemia with maturation | HL60 cells | CVCL_0002 | ||