Antibody Information
General Information of This Antibody (ID: ANTI0JQXLH)
| Antibody Name | Hu001-2 |
|||||
|---|---|---|---|---|---|---|
| Organization | Hefei Institutes of Physical Science |
|||||
| Synonyms |
Hu001-2
Click to Show/Hide
|
|||||
| Antibody Type | Monoclonal antibody (mAb) |
|||||
| Antigen Name | Inactive tyrosine-protein kinase transmembrane receptor ROR1 (ROR1) |
Antigen Info | ||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Varible Domain |
QVQLVQSGAEVKKPGASVKVSCKASGYTFTDYNLHWVRQAPGQGLEWMGYINPNHDATSY
NQKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARRVRTGTGLDDWGQGTTVTVSS Click to Show/Hide
|
|||||
| Light Chain Varible Domain |
DVVMTQSPLSLPVTLGQPASISCRSSHNIVHTNANTYLEWYQQRPGQSPRLLIYKVSNRF
SGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCFQGSRFPYTFGGGTKVEIK Click to Show/Hide
|
|||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
Hu001-2-MMAE [Investigative]
Discovered Using Cell Line-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth lnhibition value (TGl) |
39.12%
|
High ROR1 expression (ROR1 +++) | ||
| Method Description |
Cell line-derived xenograft models were established the back of immunodeficient mice (NCG or Balb/c nude), by subcutaneous injection of 5x106 (PA-1) tumor cells, and treatmen with 2.5mg/kg ADC (via the tail vein, QwƧ) after tumor volume about 100-300mm3. Determined tumor volume after the experiment, measured at day 21.
|
||||
| In Vivo Model | NCI-N87 xenograft model | ||||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth lnhibition value (TGl) |
39.71%
|
High ROR1 expression (ROR1 +++) | ||
| Method Description |
Cell line-derived xenograft models were established the back of immunodeficient mice (NCG or Balb/c nude), by subcutaneous injection of 1x107 (HCC1187) tumor cells, and treatmen with 2.5mg/kg ADC (via the tail vein, QwƧ) after tumor volume about 100-300mm3. Determined tumor volume after the experiment, measured at day 21.
|
||||
| In Vivo Model | HCC1187 xenograft model | ||||
| Experiment 3 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth lnhibition value (TGl) |
60.02%
|
High ROR1 expression (ROR1 +++) | ||
| Method Description |
Cell line-derived xenograft models were established the back of immunodeficient mice (NCG or Balb/c nude), by subcutaneous injection of 1x107 (PA-1) tumor cells, and treatmen with 2.5mg/kg ADC (via the tail vein, QwƧ) after tumor volume about 100-300mm3. Determined tumor volume after the experiment, measured at day 28.
|
||||
| In Vivo Model | PA-1 xenograft model | ||||
| Experiment 4 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth lnhibition value (TGl) |
69.85%
|
High ROR1 expression (ROR1 +++) | ||
| Method Description |
Cell line-derived xenograft models were established the back of immunodeficient mice (NCG or Balb/c nude), by subcutaneous injection of 5x106 (PA-1) tumor cells, and treatmen with 5mg/kg ADC (via the tail vein, QwƧ) after tumor volume about 100-300mm3. Determined tumor volume after the experiment, measured at day 21.
|
||||
| In Vivo Model | NCI-N87 xenograft model | ||||
| Experiment 5 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth lnhibition value (TGl) |
79.68%
|
High ROR1 expression (ROR1 +++) | ||
| Method Description |
Cell line-derived xenograft models were established the back of immunodeficient mice (NCG or Balb/c nude), by subcutaneous injection of 5x106 (MDA-MB-231) tumor cells, and treatmen with 2.5mg/kg ADC (via the tail vein, QwƧ) after tumor volume about 100-300mm3. Determined tumor volume after the experiment, measured at day 28.
Click to Show/Hide
|
||||
| In Vivo Model | MDA-MB-231 xenograft model | ||||
| Experiment 6 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth lnhibition value (TGl) |
92.31%
|
High ROR1 expression (ROR1 +++) | ||
| Method Description |
Cell line-derived xenograft models were established the back of immunodeficient mice (NCG or Balb/c nude), by subcutaneous injection of 1x107 (HCC1187) tumor cells, and treatmen with 5mg/kg ADC (via the tail vein, QwƧ) after tumor volume about 100-300mm3. Determined tumor volume after the experiment, measured at day 21.
|
||||
| In Vivo Model | HCC1187 xenograft model | ||||
| Experiment 7 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth lnhibition value (TGl) |
93.61%
|
High ROR1 expression (ROR1 +++) | ||
| Method Description |
Cell line-derived xenograft models were established the back of immunodeficient mice (NCG or Balb/c nude), by subcutaneous injection of 5x106 (MDA-MB-231) tumor cells, and treatmen with 5mg/kg ADC (via the tail vein, QwƧ) after tumor volume about 100-300mm3. Determined tumor volume after the experiment, measured at day 28.
|
||||
| In Vivo Model | MDA-MB-231 xenograft model | ||||
| Experiment 8 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth lnhibition value (TGl) |
95.79%
|
High ROR1 expression (ROR1 +++) | ||
| Method Description |
Cell line-derived xenograft models were established the back of immunodeficient mice (NCG or Balb/c nude), by subcutaneous injection of 1x107 (PA-1) tumor cells, and treatmen with 5mg/kg ADC (via the tail vein, QwƧ) after tumor volume about 100-300mm3. Determined tumor volume after the experiment, measured at day 28.
|
||||
| In Vivo Model | PA-1 xenograft model | ||||
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.09 nM
|
High ROR1 expression (ROR1 +++) | ||
| Method Description |
A total of 250-1500cells (PA-1) were plated in 150ul cell culture medium per well of a 96-well flat plate in the appropriate growth media. After 3-5h, add ADC at different concentrations respectively. Set 2-4 replicate wells for each drug concentration, as well as corresponding vehicle control and blank control wells. After 5-6 days of treatment (according to the cell growth rate to ensure sufficient cell division), pour off the culture medium, add CCK8 reaction solution (purchased from MCE, cat#HY - K0301), 100 uL per well. Incubate at 37°C until the expected color intensity is reached, and measure the cell viability (OD450nm) of each group.
Click to Show/Hide
|
||||
| In Vitro Model | Ovarian mixed germ cell tumor | PA-1 cells | CVCL_0479 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
2.3 nM
|
High ROR1 expression (ROR1 +++) | ||
| Method Description |
A total of 250-1500cells (NCI-H446) were plated in 150ul cell culture medium per well of a 96-well flat plate in the appropriate growth media. After 3-5h, add ADC at different concentrations respectively. Set 2-4 replicate wells for each drug concentration, as well as corresponding vehicle control and blank control wells. After 5-6 days of treatment (according to the cell growth rate to ensure sufficient cell division), pour off the culture medium, add CCK8 reaction solution (purchased from MCE, cat#HY - K0301), 100 uL per well. Incubate at 37°C until the expected color intensity is reached, and measure the cell viability (OD450nm) of each group.
Click to Show/Hide
|
||||
| In Vitro Model | Lung small cell carcinoma | NCI-H446 cells | CVCL_1562 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
2.8 nM
|
High ROR1 expression (ROR1 +++) | ||
| Method Description |
A total of 250-1500cells (HCC1187) were plated in 150ul cell culture medium per well of a 96-well flat plate in the appropriate growth media. After 3-5h, add ADC at different concentrations respectively. Set 2-4 replicate wells for each drug concentration, as well as corresponding vehicle control and blank control wells. After 5-6 days of treatment (according to the cell growth rate to ensure sufficient cell division), pour off the culture medium, add CCK8 reaction solution (purchased from MCE, cat#HY - K0301), 100 uL per well. Incubate at 37°C until the expected color intensity is reached, and measure the cell viability (OD450nm) of each group.
Click to Show/Hide
|
||||
| In Vitro Model | Breast ductal carcinoma | HCC1187 cells | CVCL_1247 | ||
| Experiment 4 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
6.66 nM
|
High ROR1 expression (ROR1 +++) | ||
| Method Description |
A total of 250-1500cells (SK-CO-1) were plated in 150ul cell culture medium per well of a 96-well flat plate in the appropriate growth media. After 3-5h, add ADC at different concentrations respectively. Set 2-4 replicate wells for each drug concentration, as well as corresponding vehicle control and blank control wells. After 5-6 days of treatment (according to the cell growth rate to ensure sufficient cell division), pour off the culture medium, add CCK8 reaction solution (purchased from MCE, cat#HY - K0301), 100 uL per well. Incubate at 37°C until the expected color intensity is reached, and measure the cell viability (OD450nm) of each group.
Click to Show/Hide
|
||||
| In Vitro Model | Colon adenocarcinoma | SKCO1 cells | CVCL_0626 | ||
| Experiment 5 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
8.32 nM
|
High ROR1 expression (ROR1 +++) | ||
| Method Description |
A total of 250-1500cells (NCI-N87) were plated in 150ul cell culture medium per well of a 96-well flat plate in the appropriate growth media. After 3-5h, add ADC at different concentrations respectively. Set 2-4 replicate wells for each drug concentration, as well as corresponding vehicle control and blank control wells. After 5-6 days of treatment (according to the cell growth rate to ensure sufficient cell division), pour off the culture medium, add CCK8 reaction solution (purchased from MCE, cat#HY - K0301), 100 uL per well. Incubate at 37°C until the expected color intensity is reached, and measure the cell viability (OD450nm) of each group.
Click to Show/Hide
|
||||
| In Vitro Model | Gastric tubular adenocarcinoma | NCI-N87 cells | CVCL_1603 | ||
| Experiment 6 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
12.19 nM
|
High ROR1 expression (ROR1 +++) | ||
| Method Description |
A total of 250-1500cells (HCC827) were plated in 150ul cell culture medium per well of a 96-well flat plate in the appropriate growth media. After 3-5h, add ADC at different concentrations respectively. Set 2-4 replicate wells for each drug concentration, as well as corresponding vehicle control and blank control wells. After 5-6 days of treatment (according to the cell growth rate to ensure sufficient cell division), pour off the culture medium, add CCK8 reaction solution (purchased from MCE, cat#HY - K0301), 100 uL per well. Incubate at 37°C until the expected color intensity is reached, and measure the cell viability (OD450nm) of each group.
Click to Show/Hide
|
||||
| In Vitro Model | Lung adenocarcinoma | HCC827 cells | CVCL_2063 | ||
| Experiment 7 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
12.54 nM
|
High ROR1 expression (ROR1 +++) | ||
| Method Description |
A total of 250-1500cells (MDA-MB-231) were plated in 150ul cell culture medium per well of a 96-well flat plate in the appropriate growth media. After 3-5h, add ADC at different concentrations respectively. Set 2-4 replicate wells for each drug concentration, as well as corresponding vehicle control and blank control wells. After 5-6 days of treatment (according to the cell growth rate to ensure sufficient cell division), pour off the culture medium, add CCK8 reaction solution (purchased from MCE, cat#HY - K0301), 100 uL per well. Incubate at 37°C until the expected color intensity is reached, and measure the cell viability (OD450nm) of each group.
Click to Show/Hide
|
||||
| In Vitro Model | Breast adenocarcinoma | MDA-MB-231 cells | CVCL_0062 | ||
| Experiment 8 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
13.28 nM
|
Moderate ROR1 expression (ROR1++) | ||
| Method Description |
A total of 250-1500cells (COLO-678) were plated in 150ul cell culture medium per well of a 96-well flat plate in the appropriate growth media. After 3-5h, add ADC at different concentrations respectively. Set 2-4 replicate wells for each drug concentration, as well as corresponding vehicle control and blank control wells. After 5-6 days of treatment (according to the cell growth rate to ensure sufficient cell division), pour off the culture medium, add CCK8 reaction solution (purchased from MCE, cat#HY - K0301), 100 uL per well. Incubate at 37°C until the expected color intensity is reached, and measure the cell viability (OD450nm) of each group.
Click to Show/Hide
|
||||
| In Vitro Model | Colon carcinoma | COLO-678 cells | CVCL_1129 | ||
| Experiment 9 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
17.24 nM
|
High ROR1 expression (ROR1 +++) | ||
| Method Description |
A total of 250-1500cells (HT-29) were plated in 150ul cell culture medium per well of a 96-well flat plate in the appropriate growth media. After 3-5h, add ADC at different concentrations respectively. Set 2-4 replicate wells for each drug concentration, as well as corresponding vehicle control and blank control wells. After 5-6 days of treatment (according to the cell growth rate to ensure sufficient cell division), pour off the culture medium, add CCK8 reaction solution (purchased from MCE, cat#HY - K0301), 100 uL per well. Incubate at 37°C until the expected color intensity is reached, and measure the cell viability (OD450nm) of each group.
Click to Show/Hide
|
||||
| In Vitro Model | Colon adenocarcinoma | HT-29 cells | CVCL_0320 | ||
| Experiment 10 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) | > 100 nM | Positive ROR1 expression (ROR1+++/++) | ||
| Method Description |
A total of 250-1500cells (SK-BR-3) were plated in 150ul cell culture medium per well of a 96-well flat plate in the appropriate growth media. After 3-5h, add ADC at different concentrations respectively. Set 2-4 replicate wells for each drug concentration, as well as corresponding vehicle control and blank control wells. After 5-6 days of treatment (according to the cell growth rate to ensure sufficient cell division), pour off the culture medium, add CCK8 reaction solution (purchased from MCE, cat#HY - K0301), 100 uL per well. Incubate at 37°C until the expected color intensity is reached, and measure the cell viability (OD450nm) of each group.
Click to Show/Hide
|
||||
| In Vitro Model | Breast adenocarcinoma | SK-BR-3 cells | CVCL_0033 | ||
| Experiment 11 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) | > 100 nM | Low ROR1 expression (ROR1+) | ||
| Method Description |
A total of 250-1500cells (MCF-7) were plated in 150ul cell culture medium per well of a 96-well flat plate in the appropriate growth media. After 3-5h, add ADC at different concentrations respectively. Set 2-4 replicate wells for each drug concentration, as well as corresponding vehicle control and blank control wells. After 5-6 days of treatment (according to the cell growth rate to ensure sufficient cell division), pour off the culture medium, add CCK8 reaction solution (purchased from MCE, cat#HY - K0301), 100 uL per well. Incubate at 37°C until the expected color intensity is reached, and measure the cell viability (OD450nm) of each group.
Click to Show/Hide
|
||||
| In Vitro Model | Invasive breast carcinoma | MCF-7 cells | CVCL_0031 | ||
References
