Antibody ID	ANTI0HWWNQ
Antibody Name	TPP-5657
Organization	VINCERX PHARMA GMBH
Synonyms	TPP-5657    Click to Show/Hide
Antibody Type	Monoclonal antibody (mAb)
Antibody Subtype	Humanized lgG
Antigen Name	Undisclosed					Antigen Info
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence	EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAISGSGGSTYY ADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKLTGAEYFQHWGQGTLVTVSSAS TKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGL YSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPS VFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNST YRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELT KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQ GNVFSCSVMHEALHNHYTQKSLSLSPG     Click to Show/Hide
Heavy Chain Varible Domain	EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAISGSGGSTYY ADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKLTGAEYFQHWGQGTLVTVSS     Click to Show/Hide
Heavy Chain CDR 1	SYAMS     Click to Show/Hide
Heavy Chain CDR 2	AISGSGGSTYYADSVKG     Click to Show/Hide
Heavy Chain CDR 3	LTGAEYFQH     Click to Show/Hide
Light Chain Sequence	QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGV PDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLSGVVFGGGTKLTVLGQPKAAPSV TLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAAS SYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS     Click to Show/Hide
Light Chain Varible Domain	QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGV PDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLSGVVFGGGTKLTVL     Click to Show/Hide
Light Chain CDR 1	TGSSSNIGAGYDV     Click to Show/Hide
Light Chain CDR 2	GNSNRPS     Click to Show/Hide
Light Chain CDR 3	QSYDSSLSGVV     Click to Show/Hide

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.01- 1 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H69: 2000 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 13 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Lung small cell carcinoma, Small cell lung cancer	NCI-H69 cells (+NE)		CVCL_1579
Experiment 2 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H69: 2000 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 13 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Lung small cell carcinoma, Small cell lung cancer	NCI-H69 cells (-NE)		CVCL_1579
Experiment 3 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H292: 2500 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 21 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI-H929 cells (+NE)		CVCL_1600
Experiment 4 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	100- 999 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H292: 2500 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 21 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI-H929 cells (-NE)		CVCL_1600

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.013&#451 nM
Method Description	The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI H929 cells		CVCL_1600
Experiment 2 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	103&#4599 nM
Method Description	The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI H929 cells		CVCL_1600

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	1.0- 9.9 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H69: 2000 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 6 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Lung small cell carcinoma, Small cell lung cancer	NCI-H69 cells (+NE)		CVCL_1579
Experiment 2 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	1.0- 9.9 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H69: 2000 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 7 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Lung small cell carcinoma, Small cell lung cancer	NCI-H69 cells (+NE)		CVCL_1579
Experiment 3 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H69: 2000 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 6 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Lung small cell carcinoma, Small cell lung cancer	NCI-H69 cells (-NE)		CVCL_1579
Experiment 4 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H69: 2000 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 7 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Lung small cell carcinoma, Small cell lung cancer	NCI-H69 cells (-NE)		CVCL_1579
Experiment 5 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H69: 2000 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 8 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Lung small cell carcinoma, Small cell lung cancer	NCI-H69 cells (-NE)		CVCL_1579
Experiment 6 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H69: 2000 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 8 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Lung small cell carcinoma, Small cell lung cancer	NCI-H69 cells (+NE)		CVCL_1579
Experiment 7 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	0.01- 1 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (786-0: 1500 cells/ well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 26 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Renal cell carcinoma	786-O cells (+NE)		CVCL_1051
Experiment 8 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	0.01- 1 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H292: 2500 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 15 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI-H929 cells (+NE)		CVCL_1600
Experiment 9 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	0.01- 1 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (SUM149PT 2000 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 15 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Breast inflammatory carcinoma	SUM149PT cells (+NE)		CVCL_3422
Experiment 10 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	1.0- 9.9 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (HT29: 1200 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 29 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Colon adenocarcinoma	HT29 cells (+NE)		CVCL_0320
Experiment 11 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (786-0: 1500 cells/ well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 26 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Renal cell carcinoma	786-O cells (-NE)		CVCL_1051
Experiment 12 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (HT29: 1200 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 9 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Colon adenocarcinoma	HT29 cells (-NE)		CVCL_0320
Experiment 13 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H292: 2500 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 15 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI-H929 cells (-NE)		CVCL_1600
Experiment 14 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (SUM149PT 2000 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 15 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Breast inflammatory carcinoma	SUM149PT cells (-NE)		CVCL_3422

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	1.0- 9.9 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H69: 2000 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 10 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Lung small cell carcinoma, Small cell lung cancer	NCI-H69 cells (+NE)		CVCL_1579
Experiment 2 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H69: 2000 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 10 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Lung small cell carcinoma, Small cell lung cancer	NCI-H69 cells (-NE)		CVCL_1579
Experiment 3 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	0.01- 1 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (SUM149PT 2000 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 18 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Breast inflammatory carcinoma	SUM149PT cells (+NE)		CVCL_3422
Experiment 4 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	1.0- 9.9 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (786-0: 1500 cells/ well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 28 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Renal cell carcinoma	786-O cells (+NE)		CVCL_1051
Experiment 5 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	1.0- 9.9 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H292: 2500 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 18 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI-H929 cells (+NE)		CVCL_1600
Experiment 6 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (786-0: 1500 cells/ well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 28 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Renal cell carcinoma	786-O cells (-NE)		CVCL_1051
Experiment 7 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H292: 2500 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 18 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI-H929 cells (-NE)		CVCL_1600
Experiment 8 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (SUM149PT 2000 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 18 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Breast inflammatory carcinoma	SUM149PT cells (-NE)		CVCL_3422

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	1.0- 9.9 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H69: 2000 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 16 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Lung small cell carcinoma, Small cell lung cancer	NCI-H69 cells (+NE)		CVCL_1579
Experiment 2 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H69: 2000 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 16 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Lung small cell carcinoma, Small cell lung cancer	NCI-H69 cells (-NE)		CVCL_1579
Experiment 3 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	0.01- 1 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (786-0: 1500 cells/ well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 30 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Renal cell carcinoma	786-O cells (+NE)		CVCL_1051
Experiment 4 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	0.01- 1 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H292: 2500 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 24 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI-H929 cells (+NE)		CVCL_1600
Experiment 5 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	0.01- 1 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (SUM149PT 2000 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 24 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Breast inflammatory carcinoma	SUM149PT cells (+NE)		CVCL_3422
Experiment 6 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	1.0- 9.9 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (HT29: 1200 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 33 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Colon adenocarcinoma	HT29 cells (+NE)		CVCL_0320
Experiment 7 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (786-0: 1500 cells/ well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 30 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Renal cell carcinoma	786-O cells (-NE)		CVCL_1051
Experiment 8 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (HT29: 1200 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 13 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Colon adenocarcinoma	HT29 cells (-NE)		CVCL_0320
Experiment 9 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H292: 2500 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 24 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI-H929 cells (-NE)		CVCL_1600
Experiment 10 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (SUM149PT 2000 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 24 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Breast inflammatory carcinoma	SUM149PT cells (-NE)		CVCL_3422

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	1.0- 9.9 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H69: 2000 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 21 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Lung small cell carcinoma, Small cell lung cancer	NCI-H69 cells (+NE)		CVCL_1579
Experiment 2 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H69: 2000 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 21 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Lung small cell carcinoma, Small cell lung cancer	NCI-H69 cells (-NE)		CVCL_1579
Experiment 3 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	1.0- 9.9 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (HT29: 1200 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 34 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Colon adenocarcinoma	HT29 cells (+NE)		CVCL_0320
Experiment 4 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	1.0- 9.9 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H292: 2500 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 29 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI-H929 cells (+NE)		CVCL_1600
Experiment 5 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (786-0: 1500 cells/ well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 31 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Renal cell carcinoma	786-O cells (+NE)		CVCL_1051
Experiment 6 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	100- 999 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (HT29: 1200 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 14 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Colon adenocarcinoma	HT29 cells (-NE)		CVCL_0320
Experiment 7 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	> 1000 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (786-0: 1500 cells/ well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 31 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Renal cell carcinoma	786-O cells (-NE)		CVCL_1051
Experiment 8 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	> 1000 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H292: 2500 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 29 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI-H929 cells (-NE)		CVCL_1600

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H69: 2000 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 9 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Lung small cell carcinoma, Small cell lung cancer	NCI-H69 cells (-NE)		CVCL_1579
Experiment 2 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H69: 2000 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 9 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Lung small cell carcinoma, Small cell lung cancer	NCI-H69 cells (+NE)		CVCL_1579
Experiment 3 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	1.0- 9.9 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H292: 2500 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 17 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI-H929 cells (+NE)		CVCL_1600
Experiment 4 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H292: 2500 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 17 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI-H929 cells (-NE)		CVCL_1600

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H69: 2000 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 12 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Lung small cell carcinoma, Small cell lung cancer	NCI-H69 cells (-NE)		CVCL_1579
Experiment 2 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H69: 2000 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 12 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Lung small cell carcinoma, Small cell lung cancer	NCI-H69 cells (+NE)		CVCL_1579
Experiment 3 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	1.0- 9.9 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H292: 2500 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 20 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI-H929 cells (+NE)		CVCL_1600
Experiment 4 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	100- 999 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H292: 2500 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 20 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI-H929 cells (-NE)		CVCL_1600

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H69: 2000 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 14 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Lung small cell carcinoma, Small cell lung cancer	NCI-H69 cells (-NE)		CVCL_1579
Experiment 2 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H69: 2000 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 14 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Lung small cell carcinoma, Small cell lung cancer	NCI-H69 cells (+NE)		CVCL_1579
Experiment 3 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H292: 2500 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 22 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI-H929 cells (+NE)		CVCL_1600
Experiment 4 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	100- 999 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H292: 2500 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 22 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI-H929 cells (-NE)		CVCL_1600

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H69: 2000 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 15 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Lung small cell carcinoma, Small cell lung cancer	NCI-H69 cells (-NE)		CVCL_1579
Experiment 2 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H69: 2000 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 15 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Lung small cell carcinoma, Small cell lung cancer	NCI-H69 cells (+NE)		CVCL_1579
Experiment 3 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	1.0- 9.9 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H292: 2500 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 23 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI-H929 cells (+NE)		CVCL_1600
Experiment 4 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	1.0- 9.9 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (SUM149PT 2000 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 23 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Breast inflammatory carcinoma	SUM149PT cells (+NE)		CVCL_3422
Experiment 5 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H292: 2500 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 23 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI-H929 cells (-NE)		CVCL_1600
Experiment 6 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (SUM149PT 2000 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 23 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Breast inflammatory carcinoma	SUM149PT cells (-NE)		CVCL_3422

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H69: 2000 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 23 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Lung small cell carcinoma, Small cell lung cancer	NCI-H69 cells (-NE)		CVCL_1579
Experiment 2 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H69: 2000 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 23 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Lung small cell carcinoma, Small cell lung cancer	NCI-H69 cells (+NE)		CVCL_1579
Experiment 3 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	1.0- 9.9 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (786-0: 1500 cells/ well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 33 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Renal cell carcinoma	786-O cells (+NE)		CVCL_1051
Experiment 4 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	1.0- 9.9 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H292: 2500 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 31 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI-H929 cells (+NE)		CVCL_1600
Experiment 5 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (786-0: 1500 cells/ well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 33 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Renal cell carcinoma	786-O cells (-NE)		CVCL_1051
Experiment 6 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (HT29: 1200 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 36 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Colon adenocarcinoma	HT29 cells (+NE)		CVCL_0320
Experiment 7 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H292: 2500 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 31 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI-H929 cells (-NE)		CVCL_1600
Experiment 8 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	100- 999 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (HT29: 1200 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 16 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Colon adenocarcinoma	HT29 cells (-NE)		CVCL_0320

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	13&#459.9 nM
Method Description	The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model	Renal cell carcinoma	786-O cells		CVCL_1051
Experiment 2 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	13&#459.9 nM
Method Description	The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model	Colon cancer	HT29 cells		CVCL_A8EZ
Experiment 3 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	1003&#45999 nM
Method Description	The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model	Renal cell carcinoma	786-O cells		CVCL_1051
Experiment 4 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	1003&#45999 nM
Method Description	The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model	Colon cancer	HT29 cells		CVCL_A8EZ
Experiment 5 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	1.0- 9.9 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (786-0: 1500 cells/ well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 5 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Renal cell carcinoma	786-O cells (+NE)		CVCL_1051
Experiment 6 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (786-0: 1500 cells/ well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 5 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Renal cell carcinoma	786-O cells (-NE)		CVCL_1051

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	13&#459.9 nM
Method Description	The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model	Colon cancer	HT29 cells		CVCL_A8EZ
Experiment 2 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	103&#4599 nM
Method Description	The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model	Renal cell carcinoma	786-O cells		CVCL_1051
Experiment 3 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	1003&#45999 nM
Method Description	The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model	Renal cell carcinoma	786-O cells		CVCL_1051
Experiment 4 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	1003&#45999 nM
Method Description	The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model	Colon cancer	HT29 cells		CVCL_A8EZ
Experiment 5 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	1.0- 9.9 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (786-0: 1500 cells/ well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 7 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Renal cell carcinoma	786-O cells (+NE)		CVCL_1051
Experiment 6 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	1.0- 9.9 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H292: 2500 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 6 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI-H929 cells (+NE)		CVCL_1600
Experiment 7 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	1.0- 9.9 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (SUM149PT 2000 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 6 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Breast inflammatory carcinoma	SUM149PT cells (+NE)		CVCL_3422
Experiment 8 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (786-0: 1500 cells/ well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 7 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Renal cell carcinoma	786-O cells (-NE)		CVCL_1051
Experiment 9 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H292: 2500 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 6 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI-H929 cells (-NE)		CVCL_1600
Experiment 10 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (SUM149PT 2000 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 6 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Breast inflammatory carcinoma	SUM149PT cells (-NE)		CVCL_3422

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	13&#459.9 nM
Method Description	The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model	Renal cell carcinoma	786-O cells		CVCL_1051
Experiment 2 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	13&#459.9 nM
Method Description	The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model	Colon cancer	HT29 cells		CVCL_A8EZ
Experiment 3 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	1003&#45999 nM
Method Description	The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model	Renal cell carcinoma	786-O cells		CVCL_1051
Experiment 4 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	1003&#45999 nM
Method Description	The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model	Colon cancer	HT29 cells		CVCL_A8EZ
Experiment 5 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	1.0- 9.9 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (786-0: 1500 cells/ well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 9 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Renal cell carcinoma	786-O cells (+NE)		CVCL_1051
Experiment 6 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (786-0: 1500 cells/ well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 9 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Renal cell carcinoma	786-O cells (-NE)		CVCL_1051

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	13&#459.9 nM
Method Description	The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI H929 cells		CVCL_1600
Experiment 2 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	103&#4599 nM
Method Description	The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI H929 cells		CVCL_1600

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	13&#459.9 nM
Method Description	The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI H929 cells		CVCL_1600
Experiment 2 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	103&#4599 nM
Method Description	The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI H929 cells		CVCL_1600

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	13&#459.9 nM
Method Description	The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI H929 cells		CVCL_1600
Experiment 2 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	103&#4599 nM
Method Description	The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI H929 cells		CVCL_1600

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	13&#459.9 nM
Method Description	The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI H929 cells		CVCL_1600
Experiment 2 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	103&#4599 nM
Method Description	The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI H929 cells		CVCL_1600

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	103&#4599 nM
Method Description	The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI H929 cells		CVCL_1600
Experiment 2 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	103&#4599 nM
Method Description	The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI H929 cells		CVCL_1600

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	103&#4599 nM
Method Description	The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI H929 cells		CVCL_1600
Experiment 2 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	103&#4599 nM
Method Description	The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI H929 cells		CVCL_1600

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	103&#4599 nM
Method Description	The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI H929 cells		CVCL_1600
Experiment 2 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	103&#4599 nM
Method Description	The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI H929 cells		CVCL_1600

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	103&#4599 nM
Method Description	The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI H929 cells		CVCL_1600
Experiment 2 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	103&#4599 nM
Method Description	The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI H929 cells		CVCL_1600

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	103&#4599 nM
Method Description	The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI H929 cells		CVCL_1600
Experiment 2 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	103&#4599 nM
Method Description	The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI H929 cells		CVCL_1600

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	0.01- 1 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (786-0: 1500 cells/ well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 19 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Renal cell carcinoma	786-O cells (+NE)		CVCL_1051
Experiment 2 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (786-0: 1500 cells/ well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 19 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Renal cell carcinoma	786-O cells (-NE)		CVCL_1051

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	0.01- 1 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (786-0: 1500 cells/ well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 39 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Renal cell carcinoma	786-O cells (+NE)		CVCL_1051
Experiment 2 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	0.01- 1 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H292: 2500 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 37 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI-H929 cells (+NE)		CVCL_1600
Experiment 3 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	0.01- 1 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (SUM149PT 2000 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 37 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Breast inflammatory carcinoma	SUM149PT cells (+NE)		CVCL_3422
Experiment 4 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	1.0- 9.9 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (HT29: 1200 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 42 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Colon adenocarcinoma	HT29 cells (+NE)		CVCL_0320
Experiment 5 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H292: 2500 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 37 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI-H929 cells (-NE)		CVCL_1600
Experiment 6 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (SUM149PT 2000 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 37 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Breast inflammatory carcinoma	SUM149PT cells (-NE)		CVCL_3422
Experiment 7 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	100- 999 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (HT29: 1200 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 22 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Colon adenocarcinoma	HT29 cells (-NE)		CVCL_0320
Experiment 8 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	> 1000 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (786-0: 1500 cells/ well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 39 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Renal cell carcinoma	786-O cells (-NE)		CVCL_1051

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	1.0- 9.9 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (786-0: 1500 cells/ well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 11 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Renal cell carcinoma	786-O cells (+NE)		CVCL_1051
Experiment 2 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (786-0: 1500 cells/ well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 11 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Renal cell carcinoma	786-O cells (-NE)		CVCL_1051

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	1.0- 9.9 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (786-0: 1500 cells/ well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 13 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Renal cell carcinoma	786-O cells (+NE)		CVCL_1051
Experiment 2 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	1.0- 9.9 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H292: 2500 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 8 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI-H929 cells (+NE)		CVCL_1600
Experiment 3 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	1.0- 9.9 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (SUM149PT 2000 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 8 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Breast inflammatory carcinoma	SUM149PT cells (+NE)		CVCL_3422
Experiment 4 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (786-0: 1500 cells/ well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 13 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Renal cell carcinoma	786-O cells (-NE)		CVCL_1051
Experiment 5 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H292: 2500 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 8 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI-H929 cells (-NE)		CVCL_1600
Experiment 6 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (SUM149PT 2000 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 8 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Breast inflammatory carcinoma	SUM149PT cells (-NE)		CVCL_3422

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	1.0- 9.9 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (786-0: 1500 cells/ well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 15 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Renal cell carcinoma	786-O cells (+NE)		CVCL_1051
Experiment 2 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (786-0: 1500 cells/ well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 15 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Renal cell carcinoma	786-O cells (-NE)		CVCL_1051

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	1.0- 9.9 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (786-0: 1500 cells/ well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 17 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Renal cell carcinoma	786-O cells (+NE)		CVCL_1051
Experiment 2 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	1.0- 9.9 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H292: 2500 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 9 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI-H929 cells (+NE)		CVCL_1600
Experiment 3 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	1.0- 9.9 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (SUM149PT 2000 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 9 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Breast inflammatory carcinoma	SUM149PT cells (+NE)		CVCL_3422
Experiment 4 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (786-0: 1500 cells/ well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 17 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Renal cell carcinoma	786-O cells (-NE)		CVCL_1051
Experiment 5 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H292: 2500 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 9 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI-H929 cells (-NE)		CVCL_1600
Experiment 6 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	100- 999 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (SUM149PT 2000 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 9 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Breast inflammatory carcinoma	SUM149PT cells (-NE)		CVCL_3422

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	1.0- 9.9 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (786-0: 1500 cells/ well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 20 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Renal cell carcinoma	786-O cells (+NE)		CVCL_1051
Experiment 2 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (786-0: 1500 cells/ well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 20 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Renal cell carcinoma	786-O cells (-NE)		CVCL_1051

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	1.0- 9.9 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (MOLM13: 3000 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 5 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Acute monoblastic/monocytic leukemia, Adult acute monocytic leukemia, Myelodysplastic syndrome	MOLM13 cells (-NE)		CVCL_2119
Experiment 2 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	1.0- 9.9 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (MOLM13: 3000 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 5 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Acute monoblastic/monocytic leukemia, Adult acute monocytic leukemia, Myelodysplastic syndrome	MOLM13 cells (+NE)		CVCL_2119
Experiment 3 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	1.0- 9.9 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (HT29: 1200 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 25 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Colon adenocarcinoma	HT29 cells (+NE)		CVCL_0320
Experiment 4 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	1.0- 9.9 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H292: 2500 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 11 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI-H929 cells (+NE)		CVCL_1600
Experiment 5 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	1.0- 9.9 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (SUM149PT 2000 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 11 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Breast inflammatory carcinoma	SUM149PT cells (+NE)		CVCL_3422
Experiment 6 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (786-0: 1500 cells/ well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 22 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Renal cell carcinoma	786-O cells (+NE)		CVCL_1051
Experiment 7 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	100- 999 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (786-0: 1500 cells/ well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 22 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Renal cell carcinoma	786-O cells (-NE)		CVCL_1051
Experiment 8 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	100- 999 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (HT29: 1200 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 5 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Colon adenocarcinoma	HT29 cells (-NE)		CVCL_0320
Experiment 9 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	100- 999 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H292: 2500 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 11 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI-H929 cells (-NE)		CVCL_1600
Experiment 10 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	100- 999 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (SUM149PT 2000 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 11 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Breast inflammatory carcinoma	SUM149PT cells (-NE)		CVCL_3422

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	1.0- 9.9 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H292: 2500 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 12 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI-H929 cells (+NE)		CVCL_1600
Experiment 2 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	1.0- 9.9 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (SUM149PT 2000 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 12 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Breast inflammatory carcinoma	SUM149PT cells (+NE)		CVCL_3422
Experiment 3 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (786-0: 1500 cells/ well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 23 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Renal cell carcinoma	786-O cells (+NE)		CVCL_1051
Experiment 4 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (HT29: 1200 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 26 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Colon adenocarcinoma	HT29 cells (+NE)		CVCL_0320
Experiment 5 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H292: 2500 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 12 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI-H929 cells (-NE)		CVCL_1600
Experiment 6 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (SUM149PT 2000 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 12 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Breast inflammatory carcinoma	SUM149PT cells (-NE)		CVCL_3422
Experiment 7 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	100- 999 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (786-0: 1500 cells/ well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 23 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Renal cell carcinoma	786-O cells (-NE)		CVCL_1051
Experiment 8 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	100- 999 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (HT29: 1200 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 6 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Colon adenocarcinoma	HT29 cells (-NE)		CVCL_0320

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	1.0- 9.9 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H292: 2500 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 16 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI-H929 cells (+NE)		CVCL_1600
Experiment 2 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	1.0- 9.9 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (SUM149PT 2000 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 16 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Breast inflammatory carcinoma	SUM149PT cells (+NE)		CVCL_3422
Experiment 3 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (786-0: 1500 cells/ well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 27 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Renal cell carcinoma	786-O cells (+NE)		CVCL_1051
Experiment 4 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (HT29: 1200 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 30 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Colon adenocarcinoma	HT29 cells (+NE)		CVCL_0320
Experiment 5 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H292: 2500 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 16 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI-H929 cells (-NE)		CVCL_1600
Experiment 6 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	100- 999 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (786-0: 1500 cells/ well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 27 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Renal cell carcinoma	786-O cells (-NE)		CVCL_1051
Experiment 7 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	100- 999 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (HT29: 1200 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 10 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Colon adenocarcinoma	HT29 cells (-NE)		CVCL_0320
Experiment 8 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	100- 999 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (SUM149PT 2000 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 16 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Breast inflammatory carcinoma	SUM149PT cells (-NE)		CVCL_3422

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	1- 9.9 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (SUM149PT 2000 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 10 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Breast inflammatory carcinoma	SUM149PT cells (-NE)		CVCL_3422
Experiment 2 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (786-0: 1500 cells/ well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 21 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Renal cell carcinoma	786-O cells (+NE)		CVCL_1051
Experiment 3 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H292: 2500 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 10 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI-H929 cells (-NE)		CVCL_1600
Experiment 4 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H292: 2500 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 10 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI-H929 cells (+NE)		CVCL_1600
Experiment 5 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (SUM149PT 2000 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 10 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Breast inflammatory carcinoma	SUM149PT cells (+NE)		CVCL_3422
Experiment 6 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	100- 999 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (786-0: 1500 cells/ well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 21 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Renal cell carcinoma	786-O cells (-NE)		CVCL_1051

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (786-0: 1500 cells/ well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 24 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Renal cell carcinoma	786-O cells (+NE)		CVCL_1051
Experiment 2 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H292: 2500 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 13 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI-H929 cells (+NE)		CVCL_1600
Experiment 3 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (SUM149PT 2000 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 13 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Breast inflammatory carcinoma	SUM149PT cells (-NE)		CVCL_3422
Experiment 4 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (SUM149PT 2000 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 13 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Breast inflammatory carcinoma	SUM149PT cells (+NE)		CVCL_3422
Experiment 5 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	100- 999 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (786-0: 1500 cells/ well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 24 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Renal cell carcinoma	786-O cells (-NE)		CVCL_1051
Experiment 6 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	100- 999 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (HT29: 1200 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 27 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Colon adenocarcinoma	HT29 cells (+NE)		CVCL_0320
Experiment 7 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	100- 999 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H292: 2500 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 13 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI-H929 cells (-NE)		CVCL_1600
Experiment 8 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	> 1000 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (HT29: 1200 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 7 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Colon adenocarcinoma	HT29 cells (-NE)		CVCL_0320

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (786-0: 1500 cells/ well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 25 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Renal cell carcinoma	786-O cells (+NE)		CVCL_1051
Experiment 2 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H292: 2500 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 14 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI-H929 cells (+NE)		CVCL_1600
Experiment 3 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (SUM149PT 2000 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 14 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Breast inflammatory carcinoma	SUM149PT cells (-NE)		CVCL_3422
Experiment 4 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (SUM149PT 2000 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 14 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Breast inflammatory carcinoma	SUM149PT cells (+NE)		CVCL_3422
Experiment 5 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	100- 999 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (786-0: 1500 cells/ well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 25 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Renal cell carcinoma	786-O cells (-NE)		CVCL_1051
Experiment 6 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	100- 999 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (HT29: 1200 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 28 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Colon adenocarcinoma	HT29 cells (+NE)		CVCL_0320
Experiment 7 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	100- 999 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H292: 2500 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 14 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI-H929 cells (-NE)		CVCL_1600
Experiment 8 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	> 1000 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (HT29: 1200 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 8 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Colon adenocarcinoma	HT29 cells (-NE)		CVCL_0320

Ref 1	Antibody-drug conjugates cleavable in a tumor microenvironment