Antibody Information
General Information of This Antibody
| Antibody ID | ANTI0HTOBZ |
|||||
|---|---|---|---|---|---|---|
| Antibody Name | B7H3 antibody |
|||||
| Organization | Bio-Thera Solutions, Ltd. |
|||||
| Synonyms |
B7H3 antibody
Click to Show/Hide
|
|||||
| Antibody Type | Monoclonal antibody (mAb) |
|||||
| Antibody Subtype | Humanized lgG |
|||||
| Antigen Name | CD276 antigen (CD276) |
Antigen Info | ||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Sequence |
EVQLVQSGAEVKKSGESLKISCKASGYTFTDYDINWVRQMPGKGLEWIGWIFPGDDTTKY
NEKFKGQVTLSADKSTNTAYMQWSSLKASDTAMYYCARSPSFDYWGQGTLVTVSSASTKG PSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSL SSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFL FPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRV VSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQ VSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNV FSCSVMHEALHNHYTQKSLSLSPGK Click to Show/Hide
|
|||||
| Light Chain Sequence |
QIVLTQSPGTLSLSPGERATLSCSASSTIGFMYWYQQKPGQAPRRWIYDTSKLASGVPDR
FSGSGSGTDYTLTISRLEPEDFAVYYCHQRSSYPTFGQGTKVEIKRTVAAPSVFIFPPSD EQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLS KADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Click to Show/Hide
|
|||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
CN115429893A ADC15 [Investigative]
Discovered Using Cell Line-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth lnhibition value (TGl) |
62.02%
|
Positive B7H3 expression (B7H3+++/++) | ||
| Method Description |
In the Hep-3 xenograft model, the ADCs were administered at 5 mg/kg (once, IV).
|
||||
| In Vivo Model | Hep-3 xenograft model | ||||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth lnhibition value (TGl) |
62.02%
|
Positive B7H3 expression (B7H3+++/++) | ||
| Method Description |
In the Hep-3 xenograft model, the ADCs were administered at 5 mg/kg (once, IV).
|
||||
| In Vivo Model | Hep-3 xenograft model | ||||
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
. nM
|
Negative B7H3 expression (B7H3-) | ||
| Method Description |
5000 CHO-K1 cells were seeded in 96-well cell culture plates for 24 hours before treatment. Cells were treated with ADC15 (4x the first top concentration at 200 ug/mL) for 7 days.
|
||||
| In Vitro Model | Normal | CHO-K1 cells | CVCL_0214 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.77 nM
|
Positive B7H3 expression (B7H3+++/++) | ||
| Method Description |
5000 CHO-K1-B7-H3 cells were seeded in 96-well cell culture plates for 24 hours before treatment. Cells were treated with ADC15 (4x the first top concentration at 200 ug/mL) for 7 days.
|
||||
| In Vitro Model | Normal | CHO-K1-B7-H3 cells | CVCL_0214 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.77 nM
|
Positive B7H3 expression (B7H3+++/++) | ||
| Method Description |
5000 CHO-K1-B7-H3 cells were seeded in 96-well cell culture plates for 24 hours before treatment. Cells were treated with ADC15 (4x the first top concentration at 200 ug/mL) for 7 days.
|
||||
| In Vitro Model | Normal | CHO-K1-B7-H3 cells | CVCL_0214 | ||
| Experiment 4 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
68.75 nM
|
Positive B7H3 expression (B7H3+++/++) | ||
| Method Description |
5000 Calu-6 cells were seeded in 96-well cell culture plates for 24 hours before treatment. Cells were treated with ADC15 (4x the first top concentration at 200 ug/mL) for 7 days.
|
||||
| In Vitro Model | Lung adenocarcinoma | Calu-6 cells | CVCL_0236 | ||
| Experiment 5 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
68.75 nM
|
Positive B7H3 expression (B7H3+++/++) | ||
| Method Description |
5000 Calu-6 cells were seeded in 96-well cell culture plates for 24 hours before treatment. Cells were treated with ADC15 (4x the first top concentration at 200 ug/mL) for 7 days.
|
||||
| In Vitro Model | Lung adenocarcinoma | Calu-6 cells | CVCL_0236 | ||