Antibody Information
General Information of This Antibody
| Antibody ID | ANTI0HROED |
|||||
|---|---|---|---|---|---|---|
| Antibody Name | A22 |
|||||
| Organization | EXELIXIS, INC. |
|||||
| Synonyms |
anti-IL13Ra2 antibody A22
Click to Show/Hide
|
|||||
| Antibody Type | Monoclonal antibody (mAb) |
|||||
| Antibody Subtype | Humanized lgG |
|||||
| Antigen Name | Interleukin-13 receptor subunit alpha-2 (IL13RA2) |
Antigen Info | ||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Sequence |
AVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPA
PELLGGPSVFLFPPKPKDTLMISRTPEVTcvVvDVSHEDPEVKFNWYVDGVEVHNAKTKP REEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTL PPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK Click to Show/Hide
|
|||||
| Heavy Chain Varible Domain |
QVTLRESGGGLVKPGGSLRLSCAASGFTFSTYSMNWVRQAPGKGLEWVSSITTSSSYIYY
ADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARRSLEWKYFDYWGQGTLVTVSS Click to Show/Hide
|
|||||
| Heavy Chain Hinge Region |
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS
GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGG PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREE MTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW QQGNVFSCSVMHEALHNHYTQKSLSLSPGK Click to Show/Hide
|
|||||
| Heavy Chain CDR 2 |
QVTLRESGGGLVKPGGSLRLSCAASGFTFSTYSMNWVRQAPGKGLEWVSSITTSSSYIYY
ADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARRSLEWKYFDYWGQGTLVTVSSA STKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFP Click to Show/Hide
|
|||||
| Light Chain Sequence |
EIVMTQSPSSLSASVGDRVTVTCRASQSISSYLNwYQQKPGKAPKLLIYAASSLQSGVPS
RFSGSGSGTDFTLTISSLQPEDFATYYCQQSYSPSYTFGQGTKVDIKRTVAAPSVFIFPP SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Click to Show/Hide
|
|||||
| Light Chain Varible Domain |
EIVMTQSPSSLSASVGDRVTVTCRASQSISSYLNWYQQKPGKAPKLLIYAASSLQSGVPS
RFSGSGSGTDFTLTISSLQPEDFATYYCQQSYSPSYTFGQGTKVDIK Click to Show/Hide
|
|||||
| Light Chain Constant Domain |
RTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQwKVDNALQSGNSQESVTEQD
SKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Click to Show/Hide
|
|||||
The Activity Data of This Antibody
| Antibody Activity Information 1 | [1] | |||||
|
the MFI (geometric mean) signal
|
≈40000-50000 |
a.u.
|
Human HEK 293 cells | CVCL_0045 | ||
|---|---|---|---|---|---|---|
| Antigen Expression | Positive IL13Ra2 expression (IL13Ra2+++/++) | |||||
| Antibody Function | FACS was used to evaluate the binding profiles of cells expressing IL13Ra2. | |||||
| Antibody Antigen Binding Assay | FACS was used to evaluate the binding profiles of cells expressing IL13Ra2. The samples were then read by flow cytometry and the MFI (geometric mean) signal was calculated. | |||||
| Antibody Activity Information 2 | [1] | |||||
|
the MFI (geometric mean) signal
|
≈50000-60000 |
a.u.
|
A-375 cells | CVCL_0132 | ||
| Antigen Expression | Positive IL13Ra2 expression (IL13Ra2+++/++) | |||||
| Antibody Function | FACS was used to evaluate the binding profiles of cells expressing IL13Ra2. | |||||
| Antibody Antigen Binding Assay | FACS was used to evaluate the binding profiles of cells expressing IL13Ra2. The samples were then read by flow cytometry and the MFI (geometric mean) signal was calculated. | |||||
| Antibody Activity Information 3 | [1] | |||||
|
Half Maximal Effective Concentration (EC50)
|
0.2329
|
nM
|
U266 (CD38-) cells | . | ||
| Antigen Expression | High IL13Ra2 expression (IL13Ra2 +++) | |||||
| Antibody Function | LISA was performed to assess the binding profiles of the ADCs produced as described above and their parental antibodies to human IL13Ra2-His protein. | |||||
| Antibody Antigen Binding Assay | LISA was performed to assess the binding profiles of the ADCs produced as described above and their parental antibodies to human IL13Ra2-His protein. | |||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
wO2025019776A2ADC 22-8 [Investigative]
Discovered Using Cell Line-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth lnhibition value (TGl) |
71.10%
|
Positive IL13Ra2 expression (IL13Ra2+++/++) | ||
| Method Description |
Each female BALB/c Nude mouse was inoculated subcutaneously in the right upper/lower flank region with 1x10 7of H2228 tumor cells (an NSCLC cell line having an IL13Ra2 copy number of about 2,000)in 0.1 mL of PBS mixed with MATRIGELR (1:1)for tumor development.When the mean tumor size reached about 80-150 mm 3,mice were randomized into respective treatment groups (10 mice per group)and received intravenous injections of vehicle or a single dose of the tested ADCs at 10 mg/kg on Day 1. Body weights and tumor volumes were measured twice per week until the end of the study (Day 48).
Click to Show/Hide
|
||||
| In Vivo Model | CDX Model-H2228 | ||||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth lnhibition value (TGl) |
94.50%
|
Positive IL13Ra2 expression (IL13Ra2+++/++) | ||
| Method Description |
Each female BALB/c Nude mouse was inoculated subcutaneously in the right upper flank region with 0.5x10 6of SK-MES-1 tumor cells (a non-small cell lung cancer (NSCLC)cell line having an IL13Ra2 copy number of about 4x104)in 0.1 mL of PBS for tumor development.When the mean tumor size reached about 80-150 mm 3,mice were randomized into respective treatment groups (10 mice per group)and received intravenous injections of PBS vehicle or a single dose of the tested ADCs at 10 mg/kg on Day 1. The end of the study was day 49.
Click to Show/Hide
|
||||
| In Vivo Model | CDX Model-SK-MES-1 | ||||
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | the MFI (geometric mean) signal | ≈ 40000-50000 . | Positive hIL13Ra2 expression (hIL13Ra2+++/++) | ||
| Method Description |
FACS was used to evaluate the binding profiles of A375 cells expressing IL13Ra2. The samples were then read by flow cytometry and the MFI (geometric mean) signal was calculated.
|
||||
| In Vitro Model | Amelanotic melanoma | A375 cells | CVCL_0132 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | the MFI (geometric mean) signal | ≈ 40000-50000 . | Positive hIL13Ra2 expression (hIL13Ra2+++/++) | ||
| Method Description |
FACS was used to evaluate the binding profiles of HEK293 cells engineered to express IL13Ra2 (HEK293-IL13Ra2) cells expressing IL13Ra2. The samples were then read by flow cytometry and the MFI (geometric mean) signal was calculated.
|
||||
| In Vitro Model | Normal | HEK293 cells | CVCL_0045 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
2 nM
|
High hIL13Ra2 expression (hIL13Ra2 +++) | ||
| Method Description |
The cytotoxic activity of ADC 22-8 was determined against cancer cell lines A375.FITC and anti-Hen egg-white lysozyme isotype control antibody (HEWL)conjugated to the same linker payloads.
|
||||
| In Vitro Model | Amelanotic melanoma | A375 cells | CVCL_0132 | ||
| Experiment 4 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) | > 100 nM | Positive hIL13Ra2 expression (hIL13Ra2+++/++) | ||
| Method Description |
The cytotoxic activity of ADC 22-8 was determined against cancer cell lines H1792.FITC and anti-Hen egg-white lysozyme isotype control antibody (HEWL)conjugated to the same linker payloads.
|
||||
| In Vitro Model | Lung adenocarcinoma | H1792 cells | CVCL_1495 | ||
| Experiment 5 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) | > 100 nM | Positive hIL13Ra2 expression (hIL13Ra2+++/++) | ||
| Method Description |
The cytotoxic activity of ADC 22-8 was determined against cancer cell lines H2228.FITC and anti-Hen egg-white lysozyme isotype control antibody (HEWL)conjugated to the same linker payloads.
|
||||
| In Vitro Model | Lung adenocarcinoma | H2228 cells | CVCL_1543 | ||
| Experiment 6 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) | > 100 nM | Positive hIL13Ra2 expression (hIL13Ra2+++/++) | ||
| Method Description |
The cytotoxic activity of ADC 22-8 was determined against cancer cell lines SK-MES-1.FITC and anti-Hen egg-white lysozyme isotype control antibody (HEWL)conjugated to the same linker payloads.
|
||||
| In Vitro Model | Lung squamous cell carcinoma | SK-MES-1 cells | CVCL_0630 | ||
wO2025019776A2ADC 22-2 [Investigative]
Discovered Using Cell Line-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth lnhibition value (TGl) |
81.20%
|
Positive IL13Ra2 expression (IL13Ra2+++/++) | ||
| Method Description |
Each female BALB/c Nude mouse was inoculated subcutaneously in the right upper flank region with 0.5x10 6of SK-MES-1 tumor cells (a non-small cell lung cancer (NSCLC)cell line having an IL13Ra2 copy number of about 4x104)in 0.1 mL of PBS for tumor development.When the mean tumor size reached about 80-150 mm 3,mice were randomized into respective treatment groups (10 mice per group)and received intravenous injections of PBS vehicle or a single dose of the tested ADCs at 10 mg/kg on Day 1. The end of the study was day 49.
Click to Show/Hide
|
||||
| In Vivo Model | CDX Model-SK-MES-1 | ||||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth lnhibition value (TGl) |
82.30%
|
Positive IL13Ra2 expression (IL13Ra2+++/++) | ||
| Method Description |
Each female BALB/c Nude mouse was inoculated subcutaneously in the right upper/lower flank region with 1x10 7of H2228 tumor cells (an NSCLC cell line having an IL13Ra2 copy number of about 2,000)in 0.1 mL of PBS mixed with MATRIGELR (1:1)for tumor development.When the mean tumor size reached about 80-150 mm 3,mice were randomized into respective treatment groups (10 mice per group)and received intravenous injections of vehicle or a single dose of the tested ADCs at 10 mg/kg on Day 1. Body weights and tumor volumes were measured twice per week until the end of the study (Day 48).
Click to Show/Hide
|
||||
| In Vivo Model | CDX Model-H2228 | ||||
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.01 nM
|
High hIL13Ra2 expression (hIL13Ra2 +++) | ||
| Method Description |
The cytotoxic activity of ADC 22-2 was determined against cancer cell lines A375.FITC and anti-Hen egg-white lysozyme isotype control antibody (HEWL)conjugated to the same linker payloads.
|
||||
| In Vitro Model | Amelanotic melanoma | A375 cells | CVCL_0132 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.02-0.03 nM
|
Positive hIL13Ra2 expression (hIL13Ra2+++/++) | ||
| Method Description |
The cytotoxic activity of ADC 22-2 was determined against cancer cell lines H1792.FITC and anti-Hen egg-white lysozyme isotype control antibody (HEWL)conjugated to the same linker payloads.
|
||||
| In Vitro Model | Lung adenocarcinoma | H1792 cells | CVCL_1495 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.04-0.08 nM
|
Positive hIL13Ra2 expression (hIL13Ra2+++/++) | ||
| Method Description |
The cytotoxic activity of ADC 22-2 was determined against cancer cell lines H2228.FITC and anti-Hen egg-white lysozyme isotype control antibody (HEWL)conjugated to the same linker payloads.
|
||||
| In Vitro Model | Lung adenocarcinoma | H2228 cells | CVCL_1543 | ||
| Experiment 4 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
3-63 nM
|
Positive hIL13Ra2 expression (hIL13Ra2+++/++) | ||
| Method Description |
The cytotoxic activity of ADC 22-2 was determined against cancer cell lines SK-MES-1.FITC and anti-Hen egg-white lysozyme isotype control antibody (HEWL)conjugated to the same linker payloads.
|
||||
| In Vitro Model | Lung squamous cell carcinoma | SK-MES-1 cells | CVCL_0630 | ||