General Information of This Antibody (ID: ANTI0FITJT)
Antibody Name
Trastuzumab-(κK183C+K290C)
Antigen Name
HER2
 Antigen Info 
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVARIYPTNGYTRY
ADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSS
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS
GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGG
PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNACTKPREEQYN
STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREE
MTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW
QQGNVFSCSVMHEALHNHYTQKSLSLSPG
    Click to Show/Hide
Heavy Chain Varible Domain
EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVARIYPTNGYTRY
ADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSS
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS
GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGG
PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNACTKPREEQYN
STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREE
MTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW
QQGNVFSCSVMHEALHNHYTQKSLSLSPG
    Click to Show/Hide
Light Chain Sequence
DIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYSASFLYSGVPS
RFSGSRSGTDFTLTISSLQPEDFATYYCQQHYTTPPTFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSCADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
    Click to Show/Hide
Light Chain Varible Domain
DIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYSASFLYSGVPS
RFSGSRSGTDFTLTISSLQPEDFATYYCQQHYTTPPTFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSCADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
    Click to Show/Hide
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
PF-06804103 [Phase 1 (discontinued)]
Identified from the Human Clinical Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Objective Response Rate (ORR)
52.40%
Patients Enrolled
Inclusion criteria cover HER2+/- breast/gastric cancer (Part 1A/B, Part 2A/B) resistant to standard therapy, with PS 0-1 and adequate organ function. Exclusions include CNS metastases, anthracycline overdose, Grade 3+ antibody hypersensitivity, active infections, LVEF <50%, or interstitial lung disease. Eligibility is tailored by study part, emphasizing safety and biomarker relevance.

   Click to Show/Hide
Administration Dosage
This multi-center, open-label, first-in-patient, phase I study (NCT03284723) has two parts: dose escalation (Part 1) and dose expansion (Part 2). In Part 1, groups of adult patients (pts) with HER2+ BC or HER2+ GC, who are resistant or intolerant to standard therapy or for which no standard therapy is available, received PF-06804103 intravenously once every 21 days (Q3W); dosage was escalated per cohort. Primary objectives were to evaluate the safety and tolerability of PF-06804103, characterize its dose-limiting toxicities (DLTs), and determine the recommended phase 2 dose.

   Click to Show/Hide
Related Clinical Trial
NCT Number NCT03284723  Clinical Status PHASE1
Clinical Description
A Phase 1 Dose Escalation Study Evaluating the Safety and Tolerability of PF-06804103 in Patients With Human Epidermal Growth Factor Receptor 2 (HER2) Positive and Negative Solid Tumors
Primary Endpoint
This section outlines Dose-Limiting Toxicities (DLTs) observed in Part 1A (21-day cycle) and Part 1B (28-day cycle) during the first treatment cycle, categorizing them into hematologic (Grade 4 neutropenia >7 days, febrile neutropenia, thrombocytopenia with bleeding) and non-hematologic (Grade ≥3 toxicities, treatment delays, liver abnormalities). It also details Treatment-Emergent Adverse Events (TEAEs) and Serious Adverse Events (SAEs), including definitions and timeframes (up to 89.3 weeks for Part 1A, 53.7 weeks for Part 1B). Laboratory abnormalities (hematology, chemistry, urinalysis) and vital sign criteria are summarized, along with response metrics (Objective Response, Duration of Response, PFS, TTP) in Part 2, all assessed per RECIST v1.1.

   Click to Show/Hide
Other Endpoint
This segment focuses on clinical outcomes in Part 1 (Objective Response, DR, PFS, TTP) with assessment intervals every 6 (Part 1A) or 8 weeks (Part 1B). Immunogenicity (anti-drug antibodies) and HER2 tumor analysis are included. Pharmacokinetic parameters (Cmax, t1/2, AUCinf, AUCtau, CL, Vss, Rac) for PF-06804103 ADC, total antibody, and unconjugated payload (PF-06380101) are detailed, with data from Part 1A/B (sparse sampling excluded Part 2A). Key metrics like terminal half-life, clearance, and volume of distribution are calculated per dosing intervals (504h for Part 1A, 336h for Part 1B).

   Click to Show/Hide
Discovered Using Cell Line-derived Xenograft Model
Click To Hide/Show 2 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [2]
Efficacy Data Tumor Growth Inhibition value (TGI)
100%
Moderate HER2 expression (HER2++)
Method Description
In cell line xenograft (CLX) studies, nude mice were injected subcutaneously in the flank with suspensions of 10 x106 BT474 cells, in 50% Matrigel (BD Biosciences). Mice were randomized into study groups when tumors reached approximately 150-300 mm3. Either PBS (Gibco, catalog no., 14190-144, as vehicle), PF-06804103, or PT-DM1 at different doses was administered intravenously starting on day 0 for a total of four doses, 4 days apart (four times every 4 days).

   Click to Show/Hide
In Vitro Model Invasive breast carcinoma BT474-M1 cells CVCL_0179
Experiment 2 Reporting the Activity Date of This ADC [2]
Efficacy Data Tumor Growth Inhibition value (TGI)
100%
High HER2 expression (HER2+++)
Method Description
In cell line xenograft (CLX) studies, nude mice were injected subcutaneously in the flank with suspensions of 1 x106 NCI-N87, in 50% Matrigel (BD Biosciences). Mice were randomized into study groups when tumors reached approximately 150-300 mm3. Either PBS (Gibco, catalog no., 14190-144, as vehicle), PF-06804103, or PT-DM1 at different doses was administered intravenously starting on day 0 for a total of four doses, 4 days apart (four times every 4 days).

   Click to Show/Hide
In Vitro Model Gastric tubular adenocarcinoma NCI-N87 cells CVCL_1603
References
Ref 1 PF-06804103 Dose Escalation in HER2 Positive and Negative (Negative Only in Part 2) Solid Tumors
Ref 2 PF-06804103, A Site-specific Anti-HER2 Antibody-Drug Conjugate for the Treatment of HER2-expressing Breast, Gastric, and Lung Cancers. Mol Cancer Ther. 2020 Oct;19(10):2068-2078.