Antibody Information
General Information of This Antibody (ID: ANTI0CHXMQ)
| Antibody Name | Risvutatug |
|||||
|---|---|---|---|---|---|---|
| Synonyms |
Risvutatug
Click to Show/Hide
|
|||||
| Antigen Name | CD276 antigen (CD276) |
Antigen Info | ||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Sequence |
QVQLVQSGGGVVQPGTSLRLSCAASGFIFSSSAMHWVRQAPGKGLEWVAVISYDGSNKYY
VDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARSARLYASFDYWGQGALVTVSSA STKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG LYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGP SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDEL TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ QGNVFSCSVMHEALHNHYTQKSLSLSPGK Click to Show/Hide
|
|||||
| Light Chain Sequence |
DTVVTQEPSFSVSPGGTVTLTCGLSSGSVSTSHYPSWYQQTPGQAPRMLIYNTNTRSSGV
PDRFSGSILGNKAALTITGAQADDESDYYCAIHVDRDIWVFGGGTKLTVLGQPKANPTVT LFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASS YLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTEC Click to Show/Hide
|
|||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
Risvutatug rezetecan [Phase 3]
Identified from the Human Clinical Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Progression Free Survival |
5.6 months
|
|||
| Patients Enrolled |
Eligible patients (≥18 years) must have histologically confirmed advanced/metastatic solid tumors refractory to standard therapy, ≥1 measurable lesion (RECIST 1.1), ECOG 0-1, and ≥12-week life expectancy. Key exclusions include prior B7-H3 therapy, recent anticancer treatments (chemotherapy/radiation/monoclonal antibodies within 2-4 weeks), major surgery within 4 weeks, uncontrolled comorbidities, active infections (antibiotics within 2 weeks), pregnancy, or HS-20093 component hypersensitivity. Contraception is mandatory for fertile participants.
Click to Show/Hide
|
||||
| Administration Dosage |
There are seven escalating dose cohorts. Intravenous (IV) administration of HS-20093 Q3W; Participants will continue treatment until the end of the study in the absence of unacceptable toxicities and confirmed disease progression.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT05276609 | Clinical Status | PHASE1 | ||
| Clinical Description |
ARTEMIS-001: A Phase 1, Open-label, Multi-center Study to Evaluate Safety, Tolerability, Pharmacokinetics, and Efficacy of Multiple Doses of Intravenous Administration of HS-20093 in Patients With Locally Advanced or Metastatic Solid Tumors Who Have Progressed Following Prior Therapy
|
||||
| Primary Endpoint |
This phase I study consists of two stages: the dose-escalation stage (Ia) aims to determine the maximum tolerated dose (MTD) of intravenous HS-20093 in advanced solid tumor patients within the first 21-day cycle; the dose-expansion stage (Ib) evaluates investigator-assessed objective response rate (ORR) by RECIST 1.1 (confirmed CR/PR requiring ≥4-week interval imaging) from first dose until progression or withdrawal (24-month maximum).
Click to Show/Hide
|
||||
| Other Endpoint |
Primary safety endpoints include AE incidence/severity (CTCAE v5.0) monitored from first dose to 90 days post-treatment. Pharmacokinetic parameters (Cmax, Tmax, T1/2, AUC0-t) and anti-drug antibodies (up to 90 days post-treatment) will be assessed during Cycle 1. Secondary efficacy measures include ORR (dose-escalation), duration of response (DOR), disease control rate (DCR; requiring ≥5-week SD confirmation), progression-free survival (PFS), and overall survival (OS; dose-expansion only), all evaluated per RECIST 1.1 over 24 months.
Click to Show/Hide
|
||||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Objective Response Rate (ORR) |
12
18 % |
|||
| Patients Enrolled |
Eligible patients (≥18 years) must have histologically confirmed advanced/metastatic solid tumors refractory to standard therapy, ≥1 measurable lesion (RECIST 1.1), ECOG 0-1, and ≥12-week life expectancy. Key exclusions include prior B7-H3 therapy, recent anticancer treatments (chemotherapy/radiation/monoclonal antibodies within 2-4 weeks), major surgery within 4 weeks, uncontrolled comorbidities, active infections (antibiotics within 2 weeks), pregnancy, or HS-20093 component hypersensitivity. Contraception is mandatory for fertile participants.
Click to Show/Hide
|
||||
| Administration Dosage |
There are seven escalating dose cohorts. Intravenous (IV) administration of HS-20093 Q3W; Participants will continue treatment until the end of the study in the absence of unacceptable toxicities and confirmed disease progression.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT05276609 | Clinical Status | PHASE1 | ||
| Clinical Description |
ARTEMIS-001: A Phase 1, Open-label, Multi-center Study to Evaluate Safety, Tolerability, Pharmacokinetics, and Efficacy of Multiple Doses of Intravenous Administration of HS-20093 in Patients With Locally Advanced or Metastatic Solid Tumors Who Have Progressed Following Prior Therapy
|
||||
| Primary Endpoint |
This phase I study consists of two stages: the dose-escalation stage (Ia) aims to determine the maximum tolerated dose (MTD) of intravenous HS-20093 in advanced solid tumor patients within the first 21-day cycle; the dose-expansion stage (Ib) evaluates investigator-assessed objective response rate (ORR) by RECIST 1.1 (confirmed CR/PR requiring ≥4-week interval imaging) from first dose until progression or withdrawal (24-month maximum).
Click to Show/Hide
|
||||
| Other Endpoint |
Primary safety endpoints include AE incidence/severity (CTCAE v5.0) monitored from first dose to 90 days post-treatment. Pharmacokinetic parameters (Cmax, Tmax, T1/2, AUC0-t) and anti-drug antibodies (up to 90 days post-treatment) will be assessed during Cycle 1. Secondary efficacy measures include ORR (dose-escalation), duration of response (DOR), disease control rate (DCR; requiring ≥5-week SD confirmation), progression-free survival (PFS), and overall survival (OS; dose-expansion only), all evaluated per RECIST 1.1 over 24 months.
Click to Show/Hide
|
||||
| Experiment 3 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Objective Response Rate (ORR) |
20%
|
|||
| Patients Enrolled |
Eligible patients (≥18 years) must have metastatic sarcomas refractory to first-line therapy, ≥1 measurable lesion (RECIST 1.1), ECOG 0-1, and ≥12-week life expectancy. Key exclusions include prior B7-H3 therapy, recent cancer treatments (chemotherapy/radiotherapy/antibodies within 2-4 weeks), uncontrolled metastases/comorbidities, Grade >2 toxicities (except alopecia/neurotoxicity), active infections (HBV/HCV/HIV), CYP3A4-modifying drugs, or conditions compromising safety. Fertile participants must use contraception; pregnancy is prohibited.
Click to Show/Hide
|
||||
| Administration Dosage |
Participants in cohort 1 will be randomized to receive HS-20093 at 8, 12 mg/kg.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT05830123 | Clinical Status | PHASE2 | ||
| Clinical Description |
ARTEMIS-002: A Phase 2, Multicenter, Open-label Study of Intravenous Administration of HS-20093 in Patients With Relapsed or Refractory Osteosarcoma and Other Sarcomas
|
||||
| Primary Endpoint |
The primary efficacy endpoint is investigator-assessed objective response rate (ORR) per RECIST 1.1, defined as the percentage of participants achieving confirmed complete response (CR) or partial response (PR) with ≥4 week confirmation. This will be evaluated from first dose until disease progression or withdrawal over a 24-month period.
|
||||
| Other Endpoint |
Safety assessments include AE incidence/severity (CTCAE v5.0) from first dose through 90 days post-treatment. PK parameters (Cmax, Tmax, T1/2, AUC0-t) will be measured during Cycle 1 (21-day cycle). Immunogenicity will assess anti-drug antibodies up to 90 days post-treatment. Secondary efficacy endpoints include IRC-confirmed ORR, duration of response (DOR), disease control rate (DCR), progression-free survival (PFS), 4-month PFS rate, and overall survival (OS) over 24 months.
Click to Show/Hide
|
||||
| Experiment 4 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Disease control rate (DCR) |
20
25 % |
|||
| Patients Enrolled |
Eligible patients (≥18 years) must have histologically confirmed advanced/metastatic solid tumors refractory to standard therapy, ≥1 measurable lesion (RECIST 1.1), ECOG 0-1, and ≥12-week life expectancy. Key exclusions include prior B7-H3 therapy, recent anticancer treatments (chemotherapy/radiation/monoclonal antibodies within 2-4 weeks), major surgery within 4 weeks, uncontrolled comorbidities, active infections (antibiotics within 2 weeks), pregnancy, or HS-20093 component hypersensitivity. Contraception is mandatory for fertile participants.
Click to Show/Hide
|
||||
| Administration Dosage |
There are seven escalating dose cohorts. Intravenous (IV) administration of HS-20093 Q3W; Participants will continue treatment until the end of the study in the absence of unacceptable toxicities and confirmed disease progression.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT05276609 | Clinical Status | PHASE1 | ||
| Clinical Description |
ARTEMIS-001: A Phase 1, Open-label, Multi-center Study to Evaluate Safety, Tolerability, Pharmacokinetics, and Efficacy of Multiple Doses of Intravenous Administration of HS-20093 in Patients With Locally Advanced or Metastatic Solid Tumors Who Have Progressed Following Prior Therapy
|
||||
| Primary Endpoint |
This phase I study consists of two stages: the dose-escalation stage (Ia) aims to determine the maximum tolerated dose (MTD) of intravenous HS-20093 in advanced solid tumor patients within the first 21-day cycle; the dose-expansion stage (Ib) evaluates investigator-assessed objective response rate (ORR) by RECIST 1.1 (confirmed CR/PR requiring ≥4-week interval imaging) from first dose until progression or withdrawal (24-month maximum).
Click to Show/Hide
|
||||
| Other Endpoint |
Primary safety endpoints include AE incidence/severity (CTCAE v5.0) monitored from first dose to 90 days post-treatment. Pharmacokinetic parameters (Cmax, Tmax, T1/2, AUC0-t) and anti-drug antibodies (up to 90 days post-treatment) will be assessed during Cycle 1. Secondary efficacy measures include ORR (dose-escalation), duration of response (DOR), disease control rate (DCR; requiring ≥5-week SD confirmation), progression-free survival (PFS), and overall survival (OS; dose-expansion only), all evaluated per RECIST 1.1 over 24 months.
Click to Show/Hide
|
||||
| Experiment 5 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Disease control rate (DCR) |
81.8
100 % |
|||
| Patients Enrolled |
Eligible patients (≥18 years) must have metastatic sarcomas refractory to first-line therapy, ≥1 measurable lesion (RECIST 1.1), ECOG 0-1, and ≥12-week life expectancy. Key exclusions include prior B7-H3 therapy, recent cancer treatments (chemotherapy/radiotherapy/antibodies within 2-4 weeks), uncontrolled metastases/comorbidities, Grade >2 toxicities (except alopecia/neurotoxicity), active infections (HBV/HCV/HIV), CYP3A4-modifying drugs, or conditions compromising safety. Fertile participants must use contraception; pregnancy is prohibited.
Click to Show/Hide
|
||||
| Administration Dosage |
Participants in cohort 1 will be randomized to receive HS-20093 at 8, 12 mg/kg.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT05830123 | Clinical Status | PHASE2 | ||
| Clinical Description |
ARTEMIS-002: A Phase 2, Multicenter, Open-label Study of Intravenous Administration of HS-20093 in Patients With Relapsed or Refractory Osteosarcoma and Other Sarcomas
|
||||
| Primary Endpoint |
The primary efficacy endpoint is investigator-assessed objective response rate (ORR) per RECIST 1.1, defined as the percentage of participants achieving confirmed complete response (CR) or partial response (PR) with ≥4 week confirmation. This will be evaluated from first dose until disease progression or withdrawal over a 24-month period.
|
||||
| Other Endpoint |
Safety assessments include AE incidence/severity (CTCAE v5.0) from first dose through 90 days post-treatment. PK parameters (Cmax, Tmax, T1/2, AUC0-t) will be measured during Cycle 1 (21-day cycle). Immunogenicity will assess anti-drug antibodies up to 90 days post-treatment. Secondary efficacy endpoints include IRC-confirmed ORR, duration of response (DOR), disease control rate (DCR), progression-free survival (PFS), 4-month PFS rate, and overall survival (OS) over 24 months.
Click to Show/Hide
|
||||
| Experiment 6 Reporting the Activity Date of This ADC | [3] | ||||
| Patients Enrolled |
Key exclusions include untreated CNS metastases, recent major surgery, strong CYP3A4 modulators, QT-prolonging drugs, uncontrolled comorbidities (diabetes, hypertension), or immunosuppressive conditions. Vaccination within 4 weeks or hypersensitivity to HS-20093 components also disqualify participants. Compliance and investigator-assessed safety risks are additional exclusion factors.
Click to Show/Hide
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06825624 | Clinical Status | PHASE1 | ||
| Clinical Description |
ARTEMIS-102: a Phase Ib Study of HS-20093 Combination Therapy to Evaluate the Safety, Tolerability, Pharmacokinetics and Efficacy in Patients with Advanced Metastatic Colorectal Cancer
|
||||
| Primary Endpoint |
The MTD of HS-20093 in combination with other anticancer agents is evaluated within 21-28 days post-dose in metastatic colorectal cancer patients. Safety is monitored via AEs/SAEs graded by CTCAE v5.0 over 90 days post-treatment, while efficacy (ORR, DCR, DoR, PFS, OS) is assessed by investigators per RECIST 1.1 for up to 24 months.
|
||||
| Other Endpoint |
Pharmacokinetic parameters (Cmax, Tmax, T1/2, AUC0-t) and immunogenicity (ADA) are analyzed over 24 months. Patients must have measurable lesions (RECIST 1.1), ECOG 0-1, and life expectancy ≥12 weeks. Prior B7-H3/ADC therapy, recent cytotoxic/radiotherapy, uncontrolled metastases, cardiovascular risks, active infections, or unresolved toxicities (>Grade 2) are exclusions.
Click to Show/Hide
|
||||
| Experiment 7 Reporting the Activity Date of This ADC | [4] | ||||
| Patients Enrolled |
Eligible patients (18-75 years) must have histologically confirmed metastatic solid tumors, ≥1 measurable lesion (RECIST v1.1), ECOG 0-1, and life expectancy >12 weeks. Exclusions include prior MET/EGFR-targeted therapy, recent anticancer treatments (cytotoxics/TKIs within 2 weeks; investigational drugs/ADCs within 4 weeks), uncontrolled metastases, cardiovascular diseases, Grade ≥2 unresolved toxicities, or active infections.
Click to Show/Hide
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06621563 | Clinical Status | PHASE1 | ||
| Clinical Description |
Safety, Tolerability, Efficacy, Pharmacokinetics Profile and Immunogenicity of HS-20117 in Combination with Other Drugs in Advanced Solid Tumors, a Phase Ib Clinical Trial
|
||||
| Primary Endpoint |
The safety and tolerability of HS-20117 combination therapy are evaluated by monitoring treatment-emergent AEs (graded per NCI CTCAE v5.0) from the first dose to 90 days post-treatment. The MTD/MAD is determined within 21 days, with MTD defined as the highest dose where ≤1/6 patients experience DLT and MAD based on PK/PD, safety, or exposure plateau.
Click to Show/Hide
|
||||
| Other Endpoint |
Efficacy measures include ORR, DCR, DoR, PFS, and OS (assessed via RECIST v1.1 over ~2 years), along with PK parameters (Ctrough, Tmax, AUCtau, Cmax) for HS-20117/HS-20093 and immunogenicity (ADA).
|
||||
| Experiment 8 Reporting the Activity Date of This ADC | [5] | ||||
| Patients Enrolled |
Eligible patients (≥18 years) have recurrent/metastatic HNSCC or solid tumors refractory to standard therapy, ≥1 measurable lesion (RECIST 1.1), ECOG 0-1, and life expectancy ≥12 weeks. Key exclusions include prior B7-H3 therapy, recent anticancer treatments (cytotoxics within 14 days; macromolecular agents within 28 days), uncontrolled metastases, Grade ≥2 toxicities, active infections (HBV/HCV/HIV), cardiovascular risks, or steroid dependence. Vaccination within 4 weeks or HS-20093 hypersensitivity also preclude enrollment.
Click to Show/Hide
|
||||
| Administration Dosage |
Participants in all subjucts will receive HS-20093 at 10mg/kg.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06007729 | Clinical Status | PHASE2 | ||
| Clinical Description |
ARTEMIS-006: A Phase 2 Study to Evaluate Efficacy and Safety of Intravenous Administration of HS-20093 in Patients With Head and Neck Squamous Cell Carcinoma and Other Solid Tumors
|
||||
| Primary Endpoint |
The primary efficacy endpoint is ORR by investigator and IRC assessment per RECIST 1.1 (confirmed CR/PR requiring ≥4-week repeat imaging). Key secondary endpoints include DCR, DoR (time from first response to PD/death), PFS (time to PD/death), and OS (time to death), all assessed over 24 months.
|
||||
| Other Endpoint |
Safety is evaluated via AEs (graded by NCI CTCAE v5.0) until 90 days post-treatment. PK parameters (Cmax, Tmax, T1/2, AUC0-t) are analyzed during Cycle 1 (21-day cycles), and immunogenicity measures ADA incidence. Tumor responses are compared to baseline imaging (Day -28 to -1).
|
||||
| Experiment 9 Reporting the Activity Date of This ADC | [6] | ||||
| Patients Enrolled |
Eligible patients (≥18 years) must have untreated ES-SCLC with ≥1 measurable lesion (RECIST 1.1), ECOG 0-1, and life expectancy ≥12 weeks. Key exclusions include prior B7-H3 therapy, recent radiotherapy/surgery (within 4 weeks), uncontrolled effusions, symptomatic CNS metastases, Grade ≥2 unresolved toxicities, active infections (HBV/HCV/HIV), cardiovascular risks, or concurrent CYP3A4/QT-prolonging drugs. Conditions compromising safety or protocol compliance per investigator judgement also disqualify participants.
Click to Show/Hide
|
||||
| Administration Dosage |
All subjects will receive HS-20093 at 10mg/kg.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06052423 | Clinical Status | PHASE2 | ||
| Clinical Description |
ARTEMIS-007: A Phase 2 Study to Evaluate Efficacy and Safety of HS-20093 in Patients With Extensive Stage Small Cell Lung Cancer
|
||||
| Primary Endpoint |
The primary efficacy endpoint is ORR (confirmed CR/PR requiring ≥4-week confirmation per RECIST 1.1), assessed by investigators over 18 months. Secondary endpoints include DCR (CR+PR+SD), DoR (time from initial response to progression/death), PFS (time to progression/death), and OS (time to death), all evaluated through imaging comparison to baseline tumor burden during the 18-month study period.
Click to Show/Hide
|
||||
| Other Endpoint |
Safety assessments monitor AEs (graded by CTCAE v5.0) until 90 days post-treatment. PK analysis includes Cmax, Tmax, T1/2 and AUC0-t measured during Cycle 1 (21 days), alongside immunogenicity (ADA detection). Objective tumor responses are tracked via serial imaging relative to baseline measurements, with SD requiring ≥5 weeks of stability after treatment initiation.
Click to Show/Hide
|
||||
| Experiment 10 Reporting the Activity Date of This ADC | [7] | ||||
| Patients Enrolled |
Eligible patients (≥18 years) must have confirmed SCLC that progressed after first-line platinum therapy, ≥1 measurable lesion (RECIST 1.1), ECOG 0-1, and >12-week life expectancy. Critical exclusions include: combined SCLC history, ≤30-day chemotherapy-free interval, prior B7-H3/topotecan treatment, untreated brain metastases, unresolved toxicities (>CTCAE grade 1), significant cardiorespiratory diseases, active infections, or conditions compromising protocol compliance. Fertile patients must use contraception, with pregnancy/breastfeeding excluded.
Click to Show/Hide
|
||||
| Administration Dosage |
Participants will receive HS-20093 as an intravenous (IV) infusion at dose of 8.0 mg/kg on Day 1 of each 21-day cycle until a treatment discontinuation criterion is met as specified in the protocol.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06498479 | Clinical Status | PHASE3 | ||
| Clinical Description |
ARTEMIS-008:A Multicenter, Randomized, Open-label, Phase 3 Study of HS-20093 Compared With Topotecan in Subjects With Relapsed Small Cell Lung Cancer After Platinum-based First-line Chemotherapy
|
||||
| Primary Endpoint |
The primary efficacy endpoint is overall survival (OS), measured from randomization to death from any cause over approximately 4.5 years. Key secondary endpoints include confirmed objective response rate (ORR, CR+PR), disease control rate (DCR, CR+PR+SD), duration of response (DoR), and progression-free survival (PFS), all assessed by blinded independent central review and investigators per RECIST v1.1 through the same 4.5-year timeframe.
Click to Show/Hide
|
||||
| Other Endpoint |
Safety evaluations focus on treatment-emergent adverse events (TEAEs) graded by NCI CTCAE v5.0, monitored from first dose through safety follow-up (approximately 4.5 years). Tumor response assessments include: ORR requiring confirmation (CR/PR), DCR (including SD/non-CR/non-PD), DoR (first response until progression/death), and PFS (randomization to progression/death), with imaging conducted at protocol-specified intervals.
Click to Show/Hide
|
||||
| Experiment 11 Reporting the Activity Date of This ADC | [8] | ||||
| Patients Enrolled |
Eligible patients (≥18 years) must have non-progressed limited-stage SCLC after chemoradiotherapy, ECOG 0-1, and >12-week life expectancy. Key exclusions include: mixed histology/extensive-stage disease, progression during CRT, prior B7-H3 therapy, major surgery within 4 weeks, active ILD/pneumonitis, uncontrolled comorbidities (cardiovascular/diabetic/hypertensive disorders), recent thrombosis/serious bleeding/infections, or conditions compromising safety per investigator assessment. Fertility requirements and pregnancy restrictions apply.
Click to Show/Hide
|
||||
| Administration Dosage |
Subjects in experimental arm will be given HS-20093 intravenously at a dose of 8.0 mg/kg every 3 weeks, until disease progression or until other criteria for treatment discontinuation are met.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06526624 | Clinical Status | PHASE3 | ||
| Clinical Description |
ARTEMIS-009: A Phase 3, Randomized, Controlled, Multi-center, Open-label Study of HS-20093 Versus Active Surveillance As Consolidation Therapy After Chemoradiotherapy in Subjects With Limited-Stage Small Cell Lung Cancer
|
||||
| Primary Endpoint |
The primary endpoints assess the efficacy of HS-20093 versus active surveillance, with progression-free survival (PFS) measured from randomization to disease progression or death (whichever occurs first) by Independent Review Committee (IRC) per RECIST v1.1 over approximately 6 years. Overall survival (OS), the second primary endpoint, is defined as time from randomization to death from any cause during the same 6-year period.
Click to Show/Hide
|
||||
| Other Endpoint |
Secondary efficacy assessments include PFS at 12/18 months (PFS12/PFS18), objective response rate (ORR, CR+PR), disease control rate (DCR, CR+PR+SD), and duration of response (DoR) - all evaluated by both IRC and investigators per RECIST v1.1 through 6 years. Additional measures include 24/36-month survival rates (OS24/OS36) and treatment-emergent adverse events (graded by NCI CTCAE v5.0) monitored until 90 days post-treatment.
Click to Show/Hide
|
||||
| Experiment 12 Reporting the Activity Date of This ADC | [9] | ||||
| Patients Enrolled |
Eligible patients (≥18 years) must have advanced solid tumors, ≥1 measurable lesion (RECIST 1.1), ECOG 0-1, and ≥12-week life expectancy. Key exclusions include prior PARPi/B7-H4/B7-H3 therapy, uncontrolled comorbidities (cardiovascular, diabetic, hypertensive), active infections (HBV/HCV/HIV), Grade ≥2 toxicities, pleural/abdominal effusion requiring intervention, brain metastasis, or conditions affecting safety/compliance. Fertile participants must use contraception; pregnancy/breastfeeding is prohibited. Live vaccines within 4 weeks or active autoimmune diseases are exclusionary.
Click to Show/Hide
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06769425 | Clinical Status | PHASE1 | ||
| Clinical Description |
A Phase I Study to Evaluate the Safety, Tolerability, Pharmacokinetics and Efficacy of HS-10502 Combination Treatment in Subjects with Advanced Solid Tumors
|
||||
| Primary Endpoint |
The study aims to determine the maximum tolerated dose (MTD) and maximum applicable dose (MAD) of HS-10502 during dose escalation (Stage 1), with MTD defined as the dose where ≥2/2-6 subjects experience dose-limiting toxicities (DLTs) in Cycle 1 (21 days). MAD considers PK exposure plateau, safety risks, and optimal PK-PD target concentration. In Stage 2 (dose expansion), primary efficacy is measured by objective response rate (ORR), assessing confirmed CR/PR per RECIST v1.1 (solid tumors) or RECIST v1.1+PCWG3 (prostate cancer) over ~2 years.
Click to Show/Hide
|
||||
| Other Endpoint |
Safety is evaluated via treatment-emergent adverse events (NCI CTCAE v5.0) from Cycle 1 Day 1 to 28 days post-treatment. PK parameters include Cmax, Tmax, AUC0-t (Cycle 1), and steady-state metrics (Css,max, Tss,max, Css,min, AUCss; Cycle 2). Secondary efficacy endpoints span ORR, disease control rate (DCR: CR+PR+SD≥5 weeks), duration of response (DoR), PFS (all solid tumors except prostate), rPFS (prostate, RECIST v1.1+PCWG3), OS (~4 years), and tumor-specific measures: CA-125 reduction ≥50% (ovarian) and PSA50 response/time to PSA progression (prostate
Click to Show/Hide
|
||||
| Experiment 13 Reporting the Activity Date of This ADC | [10] | ||||
| Patients Enrolled |
Eligible subjects (≥18 years) must have histologically confirmed advanced solid tumors, ≥1 measurable lesion (RECIST 1.1), ECOG 0-1, and ≥12-week life expectancy. Key exclusions: prior B7-H3 therapy, recent chemotherapy/radiotherapy (within 2-4 weeks), untreated metastases/effusions, major surgery within 4 weeks, Grade >2 toxicities, uncontrolled comorbidities (cardiovascular/diabetes/hypertension), active infections (HBV/HCV/HIV), or CYP3A4/CYP2D6-modifying drugs. Fertile participants require contraception; pregnancy/breastfeeding is prohibited. Conditions compromising safety or compliance per investigator judgment are exclusionary.
Click to Show/Hide
|
||||
| Administration Dosage |
Participants will receive HS-20093 at 8 mg/kg,Intravenous (IV) administration of HS-20093 Q3W; Participants will continue treatment until the end of the study in the absence of unacceptable toxicities and confirmed disease progression.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06001255 | Clinical Status | PHASE2 | ||
| Clinical Description |
ARTEMIS-003: A Phase 2, Open-label, Multi-center Study to Evaluate Efficacy, Safety, and Pharmacokinetics, of Intravenous Administration of HS-20093 in Patients With Metastasis Castration Resistant Prostate Cancer and Advanced Solid Tumors Who Have Progressed Following at Least One Prior Therapy
|
||||
| Primary Endpoint |
The primary endpoint is investigator-assessed objective response rate (ORR), with cohort-specific criteria: Cohort 1 (mCRPC) follows RECIST 1.1+PCWG3, requiring confirmed CR/PR (≥4-week repeat), while Cohort 2 (other solid tumors) uses RECIST 1.1 alone. Responses are tracked until disease progression/withdrawal over 24 months.
|
||||
| Other Endpoint |
Safety analysis includes AE incidence/severity (NCI CTCAE v5.0) from first dose to 90 days post-treatment. PK parameters (Cmax, Tmax, T1/2, AUC0-t) are evaluated during Cycle 1 (21-day cycles). Immunogenicity assesses anti-drug antibodies (ADAs) up to 90 days post-treatment. Secondary efficacy measures include IRC-confirmed ORR, duration of response (DoR), disease control rate (DCR: CR+PR+SD≥5 weeks), progression-free survival (PFS), radiographic PFS (rPFS for mCRPC), and overall survival (OS) over 24 months. Prostate cancer cohorts add PSA-specific endpoints: response rate (≥50% decline) and time to PSA progression.
Click to Show/Hide
|
||||
| Experiment 14 Reporting the Activity Date of This ADC | [11] | ||||
| Patients Enrolled |
Eligible patients (≥18 years) must have confirmed metastatic sarcoma (Cohort 1: soft tissue; Cohort 2: osteosarcoma) with ≥1 measurable lesion (RECIST 1.1), ECOG 0-1, and ≥12-week life expectancy. Key exclusions include prior B7-H3/TOP1i treatment (cohort-specific), recent anticancer therapies (chemotherapy/radiotherapy/antibodies within 2-4 weeks), major surgery within 4 weeks, uncontrolled comorbidities, active infections, or pregnancy. Fertile participants must use contraception throughout the study.
Click to Show/Hide
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06699576 | Clinical Status | PHASE1 | ||
| Clinical Description |
ARTEMIS-103: a Phase 1b, Open-label, Multi-center Study to Evaluate Safety, Tolerability, Pharmacokinetics and Efficacy of Intravenous Administration of HS-20093 in Combination with Other Anti-cancer Agents in Patients with Bone and Soft Tissue Sarcoma.
|
||||
| Primary Endpoint |
This study primarily aims to establish the maximum tolerated dose (MTD) of HS-20093 in combination therapies for advanced bone and soft tissue sarcomas during the first 21-day treatment cycle.
|
||||
| Other Endpoint |
Key efficacy outcomes include investigator-assessed objective response rate (ORR), disease control rate (DCR), duration of response (DoR), progression-free survival (PFS), and overall survival (OS) over 24 months. Pharmacokinetic parameters (Cmax, Tmax, T1/2, AUC0-t) and anti-drug antibody (ADA) levels will be monitored from first dose through study completion. Confirmed tumor responses require ≥1 repeat imaging (≥4 weeks for CR/PR, ≥5 weeks for SD).
Click to Show/Hide
|
||||
| Experiment 15 Reporting the Activity Date of This ADC | [12] | ||||
| Patients Enrolled |
Eligible patients (≥18 years) must have histologically confirmed advanced/metastatic solid tumors (including esophageal carcinoma) with ≥1 measurable lesion (RECIST 1.1), ECOG 0-1, and >12-week life expectancy. Key exclusions: prior B7-H3 therapy; recent anticancer treatments (chemotherapy/radiation/MAbs within 2-4 weeks); major surgery within 4 weeks; significant esophageal tumor invasion (aorta/trachea); active infections (e.g., hepatitis B/C); pregnancy; or HS-20093 hypersensitivity. Contraception is mandatory.
Click to Show/Hide
|
||||
| Administration Dosage |
Intravenous (IV) infusion of HS-20093 Q3W; Participants will receive continuous treatment until the end of the study in the absence of unacceptable toxicities and confirmed disease progression.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06112704 | Clinical Status | PHASE2 | ||
| Clinical Description |
A Phase 2, Open-label, Multi-center Study to Evaluate the Efficacy, Safety, Pharmacokinetics and Immunogenicity of HS-20093 in Patients with Advanced Esophageal Carcinoma and Other Advanced Solid Tumors (ARTEMIS-005)
|
||||
| Primary Endpoint |
The primary efficacy endpoint is objective response rate (ORR) per RECIST 1.1, defined as the proportion of patients achieving confirmed complete or partial response (CR/PR, requiring ≥4-week confirmation imaging) from first dose until progression or withdrawal (24-month assessment window).
|
||||
| Other Endpoint |
Secondary endpoints include duration of response (DOR), disease control rate (DCR; CR/PR/SD requiring ≥5-week assessment), progression-free survival (PFS), and overall survival (OS). Safety evaluates AE incidence/severity (CTCAE v5.0) from first dose to 90 days post-treatment, while pharmacokinetics and anti-drug antibody (ADA) incidence are monitored from Cycle 1 Day 1 through 90 days post-treatment.
Click to Show/Hide
|
||||
| Experiment 16 Reporting the Activity Date of This ADC | [13] | ||||
| Patients Enrolled |
Eligible patients (≥18 years) must have confirmed advanced/metastatic solid tumors, ECOG 0-1, ≥1 measurable lesion (RECIST 1.1), and ≥12-week life expectancy. Dose escalation includes treatment-refractory cases; dose expansion prioritizes treatment-naïve patients. Exclusions: prior B7-H3 therapy; intolerance to PD-L1 inhibitors/cisplatin/enzalutamide/cetuximab; recent anticancer treatments (chemotherapy/radiation/MAbs/surgery within 2-4 weeks); uncontrolled comorbidities; active infections; or pregnancy. Contraception is mandatory.
Click to Show/Hide
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06332170 | Clinical Status | PHASE1 | ||
| Clinical Description |
ARTEMIS-101: A Phase 1, Open-label, Multi-center Study to Evaluate Safety, Tolerability, Pharmacokinetics and Efficacy of Intravenous Administration of HS-20093 in Combination With Other Anti-cancer Agents in Patients With Advanced Solid Tumors
|
||||
| Primary Endpoint |
The primary objective is to determine the maximum tolerated dose (MTD) of combination therapy with HS-20093 and other anticancer agents in patients with advanced solid tumors, evaluated over the initial 21-day cycle.
|
||||
| Other Endpoint |
Key endpoints include safety (AE incidence/severity per CTCAE v5.0 through 90 days post-treatment) and efficacy measures: ORR, DCR, DOR, PFS, and OS per RECIST 1.1 (PCWG3 for prostate cancer). Prostate-specific endpoints include rPFS, TTPP, PSA response rate (≥50% decline), and TFST. Pharmacokinetics (Cmax, Tmax, T1/2, AUC0-t) and ADA incidence are monitored from first dose to study completion (24 months).
Click to Show/Hide
|
||||
| Experiment 17 Reporting the Activity Date of This ADC | [14] | ||||
| Related Clinical Trial | |||||
| NCT Number | NCT05276609 | Clinical Status | Phase 1 | ||
| Clinical Description |
ARTEMIS-001: A phase 1, open-label, multi-center study to evaluate safety, tolerability, pharmacokinetics, and efficacy of multiple doses of intravenous administration of HS-20093 in patients with locally advanced or metastatic solid tumors who have progressed following prior therapy.
|
||||
References
