General Information of This Antibody (ID: ANTI0CHXMQ)
Antibody Name
Risvutatug
Synonyms
Risvutatug
   Click to Show/Hide
Antigen Name
CD276 antigen (CD276)
 Antigen Info 
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence
QVQLVQSGGGVVQPGTSLRLSCAASGFIFSSSAMHWVRQAPGKGLEWVAVISYDGSNKYY
VDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARSARLYASFDYWGQGALVTVSSA
STKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG
LYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGP
SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS
TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDEL
TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ
QGNVFSCSVMHEALHNHYTQKSLSLSPGK
    Click to Show/Hide
Light Chain Sequence
DTVVTQEPSFSVSPGGTVTLTCGLSSGSVSTSHYPSWYQQTPGQAPRMLIYNTNTRSSGV
PDRFSGSILGNKAALTITGAQADDESDYYCAIHVDRDIWVFGGGTKLTVLGQPKANPTVT
LFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASS
YLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTEC
    Click to Show/Hide
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
Risvutatug rezetecan [Phase 3]
Identified from the Human Clinical Data
Click To Hide/Show 17 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Progression Free Survival
5.6 months
Patients Enrolled
Eligible patients (≥18 years) must have histologically confirmed advanced/metastatic solid tumors refractory to standard therapy, ≥1 measurable lesion (RECIST 1.1), ECOG 0-1, and ≥12-week life expectancy. Key exclusions include prior B7-H3 therapy, recent anticancer treatments (chemotherapy/radiation/monoclonal antibodies within 2-4 weeks), major surgery within 4 weeks, uncontrolled comorbidities, active infections (antibiotics within 2 weeks), pregnancy, or HS-20093 component hypersensitivity. Contraception is mandatory for fertile participants.

   Click to Show/Hide
Administration Dosage
There are seven escalating dose cohorts. Intravenous (IV) administration of HS-20093 Q3W; Participants will continue treatment until the end of the study in the absence of unacceptable toxicities and confirmed disease progression.
Related Clinical Trial
NCT Number NCT05276609  Clinical Status PHASE1
Clinical Description
ARTEMIS-001: A Phase 1, Open-label, Multi-center Study to Evaluate Safety, Tolerability, Pharmacokinetics, and Efficacy of Multiple Doses of Intravenous Administration of HS-20093 in Patients With Locally Advanced or Metastatic Solid Tumors Who Have Progressed Following Prior Therapy
Primary Endpoint
This phase I study consists of two stages: the dose-escalation stage (Ia) aims to determine the maximum tolerated dose (MTD) of intravenous HS-20093 in advanced solid tumor patients within the first 21-day cycle; the dose-expansion stage (Ib) evaluates investigator-assessed objective response rate (ORR) by RECIST 1.1 (confirmed CR/PR requiring ≥4-week interval imaging) from first dose until progression or withdrawal (24-month maximum).

   Click to Show/Hide
Other Endpoint
Primary safety endpoints include AE incidence/severity (CTCAE v5.0) monitored from first dose to 90 days post-treatment. Pharmacokinetic parameters (Cmax, Tmax, T1/2, AUC0-t) and anti-drug antibodies (up to 90 days post-treatment) will be assessed during Cycle 1. Secondary efficacy measures include ORR (dose-escalation), duration of response (DOR), disease control rate (DCR; requiring ≥5-week SD confirmation), progression-free survival (PFS), and overall survival (OS; dose-expansion only), all evaluated per RECIST 1.1 over 24 months.

   Click to Show/Hide
Experiment 2 Reporting the Activity Date of This ADC [1]
Efficacy Data Objective Response Rate (ORR)
12
18 %
Patients Enrolled
Eligible patients (≥18 years) must have histologically confirmed advanced/metastatic solid tumors refractory to standard therapy, ≥1 measurable lesion (RECIST 1.1), ECOG 0-1, and ≥12-week life expectancy. Key exclusions include prior B7-H3 therapy, recent anticancer treatments (chemotherapy/radiation/monoclonal antibodies within 2-4 weeks), major surgery within 4 weeks, uncontrolled comorbidities, active infections (antibiotics within 2 weeks), pregnancy, or HS-20093 component hypersensitivity. Contraception is mandatory for fertile participants.

   Click to Show/Hide
Administration Dosage
There are seven escalating dose cohorts. Intravenous (IV) administration of HS-20093 Q3W; Participants will continue treatment until the end of the study in the absence of unacceptable toxicities and confirmed disease progression.
Related Clinical Trial
NCT Number NCT05276609  Clinical Status PHASE1
Clinical Description
ARTEMIS-001: A Phase 1, Open-label, Multi-center Study to Evaluate Safety, Tolerability, Pharmacokinetics, and Efficacy of Multiple Doses of Intravenous Administration of HS-20093 in Patients With Locally Advanced or Metastatic Solid Tumors Who Have Progressed Following Prior Therapy
Primary Endpoint
This phase I study consists of two stages: the dose-escalation stage (Ia) aims to determine the maximum tolerated dose (MTD) of intravenous HS-20093 in advanced solid tumor patients within the first 21-day cycle; the dose-expansion stage (Ib) evaluates investigator-assessed objective response rate (ORR) by RECIST 1.1 (confirmed CR/PR requiring ≥4-week interval imaging) from first dose until progression or withdrawal (24-month maximum).

   Click to Show/Hide
Other Endpoint
Primary safety endpoints include AE incidence/severity (CTCAE v5.0) monitored from first dose to 90 days post-treatment. Pharmacokinetic parameters (Cmax, Tmax, T1/2, AUC0-t) and anti-drug antibodies (up to 90 days post-treatment) will be assessed during Cycle 1. Secondary efficacy measures include ORR (dose-escalation), duration of response (DOR), disease control rate (DCR; requiring ≥5-week SD confirmation), progression-free survival (PFS), and overall survival (OS; dose-expansion only), all evaluated per RECIST 1.1 over 24 months.

   Click to Show/Hide
Experiment 3 Reporting the Activity Date of This ADC [2]
Efficacy Data Objective Response Rate (ORR)
20%
Patients Enrolled
Eligible patients (≥18 years) must have metastatic sarcomas refractory to first-line therapy, ≥1 measurable lesion (RECIST 1.1), ECOG 0-1, and ≥12-week life expectancy. Key exclusions include prior B7-H3 therapy, recent cancer treatments (chemotherapy/radiotherapy/antibodies within 2-4 weeks), uncontrolled metastases/comorbidities, Grade >2 toxicities (except alopecia/neurotoxicity), active infections (HBV/HCV/HIV), CYP3A4-modifying drugs, or conditions compromising safety. Fertile participants must use contraception; pregnancy is prohibited.

   Click to Show/Hide
Administration Dosage
Participants in cohort 1 will be randomized to receive HS-20093 at 8, 12 mg/kg.
Related Clinical Trial
NCT Number NCT05830123  Clinical Status PHASE2
Clinical Description
ARTEMIS-002: A Phase 2, Multicenter, Open-label Study of Intravenous Administration of HS-20093 in Patients With Relapsed or Refractory Osteosarcoma and Other Sarcomas
Primary Endpoint
The primary efficacy endpoint is investigator-assessed objective response rate (ORR) per RECIST 1.1, defined as the percentage of participants achieving confirmed complete response (CR) or partial response (PR) with ≥4 week confirmation. This will be evaluated from first dose until disease progression or withdrawal over a 24-month period.
Other Endpoint
Safety assessments include AE incidence/severity (CTCAE v5.0) from first dose through 90 days post-treatment. PK parameters (Cmax, Tmax, T1/2, AUC0-t) will be measured during Cycle 1 (21-day cycle). Immunogenicity will assess anti-drug antibodies up to 90 days post-treatment. Secondary efficacy endpoints include IRC-confirmed ORR, duration of response (DOR), disease control rate (DCR), progression-free survival (PFS), 4-month PFS rate, and overall survival (OS) over 24 months.

   Click to Show/Hide
Experiment 4 Reporting the Activity Date of This ADC [1]
Efficacy Data Disease control rate (DCR)
20
25 %
Patients Enrolled
Eligible patients (≥18 years) must have histologically confirmed advanced/metastatic solid tumors refractory to standard therapy, ≥1 measurable lesion (RECIST 1.1), ECOG 0-1, and ≥12-week life expectancy. Key exclusions include prior B7-H3 therapy, recent anticancer treatments (chemotherapy/radiation/monoclonal antibodies within 2-4 weeks), major surgery within 4 weeks, uncontrolled comorbidities, active infections (antibiotics within 2 weeks), pregnancy, or HS-20093 component hypersensitivity. Contraception is mandatory for fertile participants.

   Click to Show/Hide
Administration Dosage
There are seven escalating dose cohorts. Intravenous (IV) administration of HS-20093 Q3W; Participants will continue treatment until the end of the study in the absence of unacceptable toxicities and confirmed disease progression.
Related Clinical Trial
NCT Number NCT05276609  Clinical Status PHASE1
Clinical Description
ARTEMIS-001: A Phase 1, Open-label, Multi-center Study to Evaluate Safety, Tolerability, Pharmacokinetics, and Efficacy of Multiple Doses of Intravenous Administration of HS-20093 in Patients With Locally Advanced or Metastatic Solid Tumors Who Have Progressed Following Prior Therapy
Primary Endpoint
This phase I study consists of two stages: the dose-escalation stage (Ia) aims to determine the maximum tolerated dose (MTD) of intravenous HS-20093 in advanced solid tumor patients within the first 21-day cycle; the dose-expansion stage (Ib) evaluates investigator-assessed objective response rate (ORR) by RECIST 1.1 (confirmed CR/PR requiring ≥4-week interval imaging) from first dose until progression or withdrawal (24-month maximum).

   Click to Show/Hide
Other Endpoint
Primary safety endpoints include AE incidence/severity (CTCAE v5.0) monitored from first dose to 90 days post-treatment. Pharmacokinetic parameters (Cmax, Tmax, T1/2, AUC0-t) and anti-drug antibodies (up to 90 days post-treatment) will be assessed during Cycle 1. Secondary efficacy measures include ORR (dose-escalation), duration of response (DOR), disease control rate (DCR; requiring ≥5-week SD confirmation), progression-free survival (PFS), and overall survival (OS; dose-expansion only), all evaluated per RECIST 1.1 over 24 months.

   Click to Show/Hide
Experiment 5 Reporting the Activity Date of This ADC [2]
Efficacy Data Disease control rate (DCR)
81.8
100 %
Patients Enrolled
Eligible patients (≥18 years) must have metastatic sarcomas refractory to first-line therapy, ≥1 measurable lesion (RECIST 1.1), ECOG 0-1, and ≥12-week life expectancy. Key exclusions include prior B7-H3 therapy, recent cancer treatments (chemotherapy/radiotherapy/antibodies within 2-4 weeks), uncontrolled metastases/comorbidities, Grade >2 toxicities (except alopecia/neurotoxicity), active infections (HBV/HCV/HIV), CYP3A4-modifying drugs, or conditions compromising safety. Fertile participants must use contraception; pregnancy is prohibited.

   Click to Show/Hide
Administration Dosage
Participants in cohort 1 will be randomized to receive HS-20093 at 8, 12 mg/kg.
Related Clinical Trial
NCT Number NCT05830123  Clinical Status PHASE2
Clinical Description
ARTEMIS-002: A Phase 2, Multicenter, Open-label Study of Intravenous Administration of HS-20093 in Patients With Relapsed or Refractory Osteosarcoma and Other Sarcomas
Primary Endpoint
The primary efficacy endpoint is investigator-assessed objective response rate (ORR) per RECIST 1.1, defined as the percentage of participants achieving confirmed complete response (CR) or partial response (PR) with ≥4 week confirmation. This will be evaluated from first dose until disease progression or withdrawal over a 24-month period.
Other Endpoint
Safety assessments include AE incidence/severity (CTCAE v5.0) from first dose through 90 days post-treatment. PK parameters (Cmax, Tmax, T1/2, AUC0-t) will be measured during Cycle 1 (21-day cycle). Immunogenicity will assess anti-drug antibodies up to 90 days post-treatment. Secondary efficacy endpoints include IRC-confirmed ORR, duration of response (DOR), disease control rate (DCR), progression-free survival (PFS), 4-month PFS rate, and overall survival (OS) over 24 months.

   Click to Show/Hide
Experiment 6 Reporting the Activity Date of This ADC [3]
Patients Enrolled
Key exclusions include untreated CNS metastases, recent major surgery, strong CYP3A4 modulators, QT-prolonging drugs, uncontrolled comorbidities (diabetes, hypertension), or immunosuppressive conditions. Vaccination within 4 weeks or hypersensitivity to HS-20093 components also disqualify participants. Compliance and investigator-assessed safety risks are additional exclusion factors.

   Click to Show/Hide
Related Clinical Trial
NCT Number NCT06825624  Clinical Status PHASE1
Clinical Description
ARTEMIS-102: a Phase Ib Study of HS-20093 Combination Therapy to Evaluate the Safety, Tolerability, Pharmacokinetics and Efficacy in Patients with Advanced Metastatic Colorectal Cancer
Primary Endpoint
The MTD of HS-20093 in combination with other anticancer agents is evaluated within 21-28 days post-dose in metastatic colorectal cancer patients. Safety is monitored via AEs/SAEs graded by CTCAE v5.0 over 90 days post-treatment, while efficacy (ORR, DCR, DoR, PFS, OS) is assessed by investigators per RECIST 1.1 for up to 24 months.
Other Endpoint
Pharmacokinetic parameters (Cmax, Tmax, T1/2, AUC0-t) and immunogenicity (ADA) are analyzed over 24 months. Patients must have measurable lesions (RECIST 1.1), ECOG 0-1, and life expectancy ≥12 weeks. Prior B7-H3/ADC therapy, recent cytotoxic/radiotherapy, uncontrolled metastases, cardiovascular risks, active infections, or unresolved toxicities (>Grade 2) are exclusions.

   Click to Show/Hide
Experiment 7 Reporting the Activity Date of This ADC [4]
Patients Enrolled
Eligible patients (18-75 years) must have histologically confirmed metastatic solid tumors, ≥1 measurable lesion (RECIST v1.1), ECOG 0-1, and life expectancy >12 weeks. Exclusions include prior MET/EGFR-targeted therapy, recent anticancer treatments (cytotoxics/TKIs within 2 weeks; investigational drugs/ADCs within 4 weeks), uncontrolled metastases, cardiovascular diseases, Grade ≥2 unresolved toxicities, or active infections.

   Click to Show/Hide
Related Clinical Trial
NCT Number NCT06621563  Clinical Status PHASE1
Clinical Description
Safety, Tolerability, Efficacy, Pharmacokinetics Profile and Immunogenicity of HS-20117 in Combination with Other Drugs in Advanced Solid Tumors, a Phase Ib Clinical Trial
Primary Endpoint
The safety and tolerability of HS-20117 combination therapy are evaluated by monitoring treatment-emergent AEs (graded per NCI CTCAE v5.0) from the first dose to 90 days post-treatment. The MTD/MAD is determined within 21 days, with MTD defined as the highest dose where ≤1/6 patients experience DLT and MAD based on PK/PD, safety, or exposure plateau.

   Click to Show/Hide
Other Endpoint
Efficacy measures include ORR, DCR, DoR, PFS, and OS (assessed via RECIST v1.1 over ~2 years), along with PK parameters (Ctrough, Tmax, AUCtau, Cmax) for HS-20117/HS-20093 and immunogenicity (ADA).
Experiment 8 Reporting the Activity Date of This ADC [5]
Patients Enrolled
Eligible patients (≥18 years) have recurrent/metastatic HNSCC or solid tumors refractory to standard therapy, ≥1 measurable lesion (RECIST 1.1), ECOG 0-1, and life expectancy ≥12 weeks. Key exclusions include prior B7-H3 therapy, recent anticancer treatments (cytotoxics within 14 days; macromolecular agents within 28 days), uncontrolled metastases, Grade ≥2 toxicities, active infections (HBV/HCV/HIV), cardiovascular risks, or steroid dependence. Vaccination within 4 weeks or HS-20093 hypersensitivity also preclude enrollment.

   Click to Show/Hide
Administration Dosage
Participants in all subjucts will receive HS-20093 at 10mg/kg.
Related Clinical Trial
NCT Number NCT06007729  Clinical Status PHASE2
Clinical Description
ARTEMIS-006: A Phase 2 Study to Evaluate Efficacy and Safety of Intravenous Administration of HS-20093 in Patients With Head and Neck Squamous Cell Carcinoma and Other Solid Tumors
Primary Endpoint
The primary efficacy endpoint is ORR by investigator and IRC assessment per RECIST 1.1 (confirmed CR/PR requiring ≥4-week repeat imaging). Key secondary endpoints include DCR, DoR (time from first response to PD/death), PFS (time to PD/death), and OS (time to death), all assessed over 24 months.
Other Endpoint
Safety is evaluated via AEs (graded by NCI CTCAE v5.0) until 90 days post-treatment. PK parameters (Cmax, Tmax, T1/2, AUC0-t) are analyzed during Cycle 1 (21-day cycles), and immunogenicity measures ADA incidence. Tumor responses are compared to baseline imaging (Day -28 to -1).
Experiment 9 Reporting the Activity Date of This ADC [6]
Patients Enrolled
Eligible patients (≥18 years) must have untreated ES-SCLC with ≥1 measurable lesion (RECIST 1.1), ECOG 0-1, and life expectancy ≥12 weeks. Key exclusions include prior B7-H3 therapy, recent radiotherapy/surgery (within 4 weeks), uncontrolled effusions, symptomatic CNS metastases, Grade ≥2 unresolved toxicities, active infections (HBV/HCV/HIV), cardiovascular risks, or concurrent CYP3A4/QT-prolonging drugs. Conditions compromising safety or protocol compliance per investigator judgement also disqualify participants.

   Click to Show/Hide
Administration Dosage
All subjects will receive HS-20093 at 10mg/kg.
Related Clinical Trial
NCT Number NCT06052423  Clinical Status PHASE2
Clinical Description
ARTEMIS-007: A Phase 2 Study to Evaluate Efficacy and Safety of HS-20093 in Patients With Extensive Stage Small Cell Lung Cancer
Primary Endpoint
The primary efficacy endpoint is ORR (confirmed CR/PR requiring ≥4-week confirmation per RECIST 1.1), assessed by investigators over 18 months. Secondary endpoints include DCR (CR+PR+SD), DoR (time from initial response to progression/death), PFS (time to progression/death), and OS (time to death), all evaluated through imaging comparison to baseline tumor burden during the 18-month study period.

   Click to Show/Hide
Other Endpoint
Safety assessments monitor AEs (graded by CTCAE v5.0) until 90 days post-treatment. PK analysis includes Cmax, Tmax, T1/2 and AUC0-t measured during Cycle 1 (21 days), alongside immunogenicity (ADA detection). Objective tumor responses are tracked via serial imaging relative to baseline measurements, with SD requiring ≥5 weeks of stability after treatment initiation.

   Click to Show/Hide
Experiment 10 Reporting the Activity Date of This ADC [7]
Patients Enrolled
Eligible patients (≥18 years) must have confirmed SCLC that progressed after first-line platinum therapy, ≥1 measurable lesion (RECIST 1.1), ECOG 0-1, and >12-week life expectancy. Critical exclusions include: combined SCLC history, ≤30-day chemotherapy-free interval, prior B7-H3/topotecan treatment, untreated brain metastases, unresolved toxicities (>CTCAE grade 1), significant cardiorespiratory diseases, active infections, or conditions compromising protocol compliance. Fertile patients must use contraception, with pregnancy/breastfeeding excluded.

   Click to Show/Hide
Administration Dosage
Participants will receive HS-20093 as an intravenous (IV) infusion at dose of 8.0 mg/kg on Day 1 of each 21-day cycle until a treatment discontinuation criterion is met as specified in the protocol.
Related Clinical Trial
NCT Number NCT06498479  Clinical Status PHASE3
Clinical Description
ARTEMIS-008:A Multicenter, Randomized, Open-label, Phase 3 Study of HS-20093 Compared With Topotecan in Subjects With Relapsed Small Cell Lung Cancer After Platinum-based First-line Chemotherapy
Primary Endpoint
The primary efficacy endpoint is overall survival (OS), measured from randomization to death from any cause over approximately 4.5 years. Key secondary endpoints include confirmed objective response rate (ORR, CR+PR), disease control rate (DCR, CR+PR+SD), duration of response (DoR), and progression-free survival (PFS), all assessed by blinded independent central review and investigators per RECIST v1.1 through the same 4.5-year timeframe.

   Click to Show/Hide
Other Endpoint
Safety evaluations focus on treatment-emergent adverse events (TEAEs) graded by NCI CTCAE v5.0, monitored from first dose through safety follow-up (approximately 4.5 years). Tumor response assessments include: ORR requiring confirmation (CR/PR), DCR (including SD/non-CR/non-PD), DoR (first response until progression/death), and PFS (randomization to progression/death), with imaging conducted at protocol-specified intervals.

   Click to Show/Hide
Experiment 11 Reporting the Activity Date of This ADC [8]
Patients Enrolled
Eligible patients (≥18 years) must have non-progressed limited-stage SCLC after chemoradiotherapy, ECOG 0-1, and >12-week life expectancy. Key exclusions include: mixed histology/extensive-stage disease, progression during CRT, prior B7-H3 therapy, major surgery within 4 weeks, active ILD/pneumonitis, uncontrolled comorbidities (cardiovascular/diabetic/hypertensive disorders), recent thrombosis/serious bleeding/infections, or conditions compromising safety per investigator assessment. Fertility requirements and pregnancy restrictions apply.

   Click to Show/Hide
Administration Dosage
Subjects in experimental arm will be given HS-20093 intravenously at a dose of 8.0 mg/kg every 3 weeks, until disease progression or until other criteria for treatment discontinuation are met.
Related Clinical Trial
NCT Number NCT06526624  Clinical Status PHASE3
Clinical Description
ARTEMIS-009: A Phase 3, Randomized, Controlled, Multi-center, Open-label Study of HS-20093 Versus Active Surveillance As Consolidation Therapy After Chemoradiotherapy in Subjects With Limited-Stage Small Cell Lung Cancer
Primary Endpoint
The primary endpoints assess the efficacy of HS-20093 versus active surveillance, with progression-free survival (PFS) measured from randomization to disease progression or death (whichever occurs first) by Independent Review Committee (IRC) per RECIST v1.1 over approximately 6 years. Overall survival (OS), the second primary endpoint, is defined as time from randomization to death from any cause during the same 6-year period.

   Click to Show/Hide
Other Endpoint
Secondary efficacy assessments include PFS at 12/18 months (PFS12/PFS18), objective response rate (ORR, CR+PR), disease control rate (DCR, CR+PR+SD), and duration of response (DoR) - all evaluated by both IRC and investigators per RECIST v1.1 through 6 years. Additional measures include 24/36-month survival rates (OS24/OS36) and treatment-emergent adverse events (graded by NCI CTCAE v5.0) monitored until 90 days post-treatment.

   Click to Show/Hide
Experiment 12 Reporting the Activity Date of This ADC [9]
Patients Enrolled
Eligible patients (≥18 years) must have advanced solid tumors, ≥1 measurable lesion (RECIST 1.1), ECOG 0-1, and ≥12-week life expectancy. Key exclusions include prior PARPi/B7-H4/B7-H3 therapy, uncontrolled comorbidities (cardiovascular, diabetic, hypertensive), active infections (HBV/HCV/HIV), Grade ≥2 toxicities, pleural/abdominal effusion requiring intervention, brain metastasis, or conditions affecting safety/compliance. Fertile participants must use contraception; pregnancy/breastfeeding is prohibited. Live vaccines within 4 weeks or active autoimmune diseases are exclusionary.

   Click to Show/Hide
Related Clinical Trial
NCT Number NCT06769425  Clinical Status PHASE1
Clinical Description
A Phase I Study to Evaluate the Safety, Tolerability, Pharmacokinetics and Efficacy of HS-10502 Combination Treatment in Subjects with Advanced Solid Tumors
Primary Endpoint
The study aims to determine the maximum tolerated dose (MTD) and maximum applicable dose (MAD) of HS-10502 during dose escalation (Stage 1), with MTD defined as the dose where ≥2/2-6 subjects experience dose-limiting toxicities (DLTs) in Cycle 1 (21 days). MAD considers PK exposure plateau, safety risks, and optimal PK-PD target concentration. In Stage 2 (dose expansion), primary efficacy is measured by objective response rate (ORR), assessing confirmed CR/PR per RECIST v1.1 (solid tumors) or RECIST v1.1+PCWG3 (prostate cancer) over ~2 years.

   Click to Show/Hide
Other Endpoint
Safety is evaluated via treatment-emergent adverse events (NCI CTCAE v5.0) from Cycle 1 Day 1 to 28 days post-treatment. PK parameters include Cmax, Tmax, AUC0-t (Cycle 1), and steady-state metrics (Css,max, Tss,max, Css,min, AUCss; Cycle 2). Secondary efficacy endpoints span ORR, disease control rate (DCR: CR+PR+SD≥5 weeks), duration of response (DoR), PFS (all solid tumors except prostate), rPFS (prostate, RECIST v1.1+PCWG3), OS (~4 years), and tumor-specific measures: CA-125 reduction ≥50% (ovarian) and PSA50 response/time to PSA progression (prostate

   Click to Show/Hide
Experiment 13 Reporting the Activity Date of This ADC [10]
Patients Enrolled
Eligible subjects (≥18 years) must have histologically confirmed advanced solid tumors, ≥1 measurable lesion (RECIST 1.1), ECOG 0-1, and ≥12-week life expectancy. Key exclusions: prior B7-H3 therapy, recent chemotherapy/radiotherapy (within 2-4 weeks), untreated metastases/effusions, major surgery within 4 weeks, Grade >2 toxicities, uncontrolled comorbidities (cardiovascular/diabetes/hypertension), active infections (HBV/HCV/HIV), or CYP3A4/CYP2D6-modifying drugs. Fertile participants require contraception; pregnancy/breastfeeding is prohibited. Conditions compromising safety or compliance per investigator judgment are exclusionary.

   Click to Show/Hide
Administration Dosage
Participants will receive HS-20093 at 8 mg/kg,Intravenous (IV) administration of HS-20093 Q3W; Participants will continue treatment until the end of the study in the absence of unacceptable toxicities and confirmed disease progression.
Related Clinical Trial
NCT Number NCT06001255  Clinical Status PHASE2
Clinical Description
ARTEMIS-003: A Phase 2, Open-label, Multi-center Study to Evaluate Efficacy, Safety, and Pharmacokinetics, of Intravenous Administration of HS-20093 in Patients With Metastasis Castration Resistant Prostate Cancer and Advanced Solid Tumors Who Have Progressed Following at Least One Prior Therapy
Primary Endpoint
The primary endpoint is investigator-assessed objective response rate (ORR), with cohort-specific criteria: Cohort 1 (mCRPC) follows RECIST 1.1+PCWG3, requiring confirmed CR/PR (≥4-week repeat), while Cohort 2 (other solid tumors) uses RECIST 1.1 alone. Responses are tracked until disease progression/withdrawal over 24 months.
Other Endpoint
Safety analysis includes AE incidence/severity (NCI CTCAE v5.0) from first dose to 90 days post-treatment. PK parameters (Cmax, Tmax, T1/2, AUC0-t) are evaluated during Cycle 1 (21-day cycles). Immunogenicity assesses anti-drug antibodies (ADAs) up to 90 days post-treatment. Secondary efficacy measures include IRC-confirmed ORR, duration of response (DoR), disease control rate (DCR: CR+PR+SD≥5 weeks), progression-free survival (PFS), radiographic PFS (rPFS for mCRPC), and overall survival (OS) over 24 months. Prostate cancer cohorts add PSA-specific endpoints: response rate (≥50% decline) and time to PSA progression.

   Click to Show/Hide
Experiment 14 Reporting the Activity Date of This ADC [11]
Patients Enrolled
Eligible patients (≥18 years) must have confirmed metastatic sarcoma (Cohort 1: soft tissue; Cohort 2: osteosarcoma) with ≥1 measurable lesion (RECIST 1.1), ECOG 0-1, and ≥12-week life expectancy. Key exclusions include prior B7-H3/TOP1i treatment (cohort-specific), recent anticancer therapies (chemotherapy/radiotherapy/antibodies within 2-4 weeks), major surgery within 4 weeks, uncontrolled comorbidities, active infections, or pregnancy. Fertile participants must use contraception throughout the study.

   Click to Show/Hide
Related Clinical Trial
NCT Number NCT06699576  Clinical Status PHASE1
Clinical Description
ARTEMIS-103: a Phase 1b, Open-label, Multi-center Study to Evaluate Safety, Tolerability, Pharmacokinetics and Efficacy of Intravenous Administration of HS-20093 in Combination with Other Anti-cancer Agents in Patients with Bone and Soft Tissue Sarcoma.
Primary Endpoint
This study primarily aims to establish the maximum tolerated dose (MTD) of HS-20093 in combination therapies for advanced bone and soft tissue sarcomas during the first 21-day treatment cycle.
Other Endpoint
Key efficacy outcomes include investigator-assessed objective response rate (ORR), disease control rate (DCR), duration of response (DoR), progression-free survival (PFS), and overall survival (OS) over 24 months. Pharmacokinetic parameters (Cmax, Tmax, T1/2, AUC0-t) and anti-drug antibody (ADA) levels will be monitored from first dose through study completion. Confirmed tumor responses require ≥1 repeat imaging (≥4 weeks for CR/PR, ≥5 weeks for SD).

   Click to Show/Hide
Experiment 15 Reporting the Activity Date of This ADC [12]
Patients Enrolled
Eligible patients (≥18 years) must have histologically confirmed advanced/metastatic solid tumors (including esophageal carcinoma) with ≥1 measurable lesion (RECIST 1.1), ECOG 0-1, and >12-week life expectancy. Key exclusions: prior B7-H3 therapy; recent anticancer treatments (chemotherapy/radiation/MAbs within 2-4 weeks); major surgery within 4 weeks; significant esophageal tumor invasion (aorta/trachea); active infections (e.g., hepatitis B/C); pregnancy; or HS-20093 hypersensitivity. Contraception is mandatory.

   Click to Show/Hide
Administration Dosage
Intravenous (IV) infusion of HS-20093 Q3W; Participants will receive continuous treatment until the end of the study in the absence of unacceptable toxicities and confirmed disease progression.
Related Clinical Trial
NCT Number NCT06112704  Clinical Status PHASE2
Clinical Description
A Phase 2, Open-label, Multi-center Study to Evaluate the Efficacy, Safety, Pharmacokinetics and Immunogenicity of HS-20093 in Patients with Advanced Esophageal Carcinoma and Other Advanced Solid Tumors (ARTEMIS-005)
Primary Endpoint
The primary efficacy endpoint is objective response rate (ORR) per RECIST 1.1, defined as the proportion of patients achieving confirmed complete or partial response (CR/PR, requiring ≥4-week confirmation imaging) from first dose until progression or withdrawal (24-month assessment window).
Other Endpoint
Secondary endpoints include duration of response (DOR), disease control rate (DCR; CR/PR/SD requiring ≥5-week assessment), progression-free survival (PFS), and overall survival (OS). Safety evaluates AE incidence/severity (CTCAE v5.0) from first dose to 90 days post-treatment, while pharmacokinetics and anti-drug antibody (ADA) incidence are monitored from Cycle 1 Day 1 through 90 days post-treatment.

   Click to Show/Hide
Experiment 16 Reporting the Activity Date of This ADC [13]
Patients Enrolled
Eligible patients (≥18 years) must have confirmed advanced/metastatic solid tumors, ECOG 0-1, ≥1 measurable lesion (RECIST 1.1), and ≥12-week life expectancy. Dose escalation includes treatment-refractory cases; dose expansion prioritizes treatment-naïve patients. Exclusions: prior B7-H3 therapy; intolerance to PD-L1 inhibitors/cisplatin/enzalutamide/cetuximab; recent anticancer treatments (chemotherapy/radiation/MAbs/surgery within 2-4 weeks); uncontrolled comorbidities; active infections; or pregnancy. Contraception is mandatory.

   Click to Show/Hide
Related Clinical Trial
NCT Number NCT06332170  Clinical Status PHASE1
Clinical Description
ARTEMIS-101: A Phase 1, Open-label, Multi-center Study to Evaluate Safety, Tolerability, Pharmacokinetics and Efficacy of Intravenous Administration of HS-20093 in Combination With Other Anti-cancer Agents in Patients With Advanced Solid Tumors
Primary Endpoint
The primary objective is to determine the maximum tolerated dose (MTD) of combination therapy with HS-20093 and other anticancer agents in patients with advanced solid tumors, evaluated over the initial 21-day cycle.
Other Endpoint
Key endpoints include safety (AE incidence/severity per CTCAE v5.0 through 90 days post-treatment) and efficacy measures: ORR, DCR, DOR, PFS, and OS per RECIST 1.1 (PCWG3 for prostate cancer). Prostate-specific endpoints include rPFS, TTPP, PSA response rate (≥50% decline), and TFST. Pharmacokinetics (Cmax, Tmax, T1/2, AUC0-t) and ADA incidence are monitored from first dose to study completion (24 months).

   Click to Show/Hide
Experiment 17 Reporting the Activity Date of This ADC [14]
Related Clinical Trial
NCT Number NCT05276609  Clinical Status Phase 1
Clinical Description
ARTEMIS-001: A phase 1, open-label, multi-center study to evaluate safety, tolerability, pharmacokinetics, and efficacy of multiple doses of intravenous administration of HS-20093 in patients with locally advanced or metastatic solid tumors who have progressed following prior therapy.
References
Ref 1 ARTEMIS-001: Phase 1 Study of the HS-20093 in Patients With Advanced Solid Tumors
Ref 2 ARTEMIS-002: HS-20093 in Patients With Relapsed or Refractory Osteosarcoma and Other Sarcomas
Ref 3 ARTEMIS-102: HS-20093 Combinations in Patients with Advanced Metastatic Colorectal Cancer
Ref 4 Phase Ib Trial of HS-20117 in Combination with Other Drugs in Advanced Solid Tumors
Ref 5 ARTEMIS-006: HS-20093 in Patients With Head and Neck Squamous Cell Carcinoma and Other Solid Tumors
Ref 6 ARTEMIS-007: HS-20093 in Patients With Extensive Stage Small Cell Lung Cancer
Ref 7 ARTEMIS-008:HS-20093 Compared With Topotecan in Subjects With Relapsed Small Cell Lung Cancer
Ref 8 A Study of HS-20093 vs Active Surveillance in Limited-Stage Small Cell Lung Cancer
Ref 9 HS-10502 Combination Treatment in Patients with Advanced Solid Tumors
Ref 10 ARTEMIS-003: HS-20093 in Patients With Metastatic Castrate-resistant Prostate Cancer (mCRPC) and Advanced Solid Tumors
Ref 11 ARTEMIS-103: Phase 1b Study of HS-20093 Combinations in Patients with Bone and Soft Tissue Sarcoma.
Ref 12 HS-20093 in Patients with Advanced Esophageal Carcinoma and Other Advanced Solid Tumors
Ref 13 ARTEMIS-101: A Study of HS-20093 Combinations in Patients With Advanced Solid Tumors
Ref 14 ARTEMIS-001: A Phase 1, Open-label, Multi-center Study to Evaluate Safety, Tolerability, Pharmacokinetics, and Efficacy of Multiple Doses of Intravenous Administration of HS-20093 in Patients With Locally Advanced or Metastatic Solid Tumors Who Have Progressed Following Prior Therapy, NCT05276609