Antibody Information
General Information of This Antibody (ID: ANTI0CGLJV)
| Antibody Name | CM311-18D10-VH6/VL1 |
|||||
|---|---|---|---|---|---|---|
| Organization | SHANGHAI MIRACOGEN INC. | KEYMED BIOSCIENCES CO., LTD |
|||||
| Synonyms |
h18D10.v26
Click to Show/Hide
|
|||||
| Antibody Type | Monoclonal antibody (mAb) |
|||||
| Antibody Subtype | Humanized lgG |
|||||
| Antigen Name | Claudin-18.2 (CLDN18.2) |
Antigen Info | ||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Sequence |
QVQLQESGPGLVKPSETLSLTCTVSGGSISSNYAWNWIRQPPGKGLEWIGYIYYSGNTNY
NPSLKSRVTISRDTSKNQFSLKLSSVTAADTAVYYCATSYYGNSFIYWGQGTLVTVSS Click to Show/Hide
|
|||||
| Heavy Chain CDR 1 |
GGSISSNYAWN
Click to Show/Hide
|
|||||
| Heavy Chain CDR 2 |
YIYYSGNTNYNPSLKS
Click to Show/Hide
|
|||||
| Heavy Chain CDR 3 |
SYYGNSFIY
Click to Show/Hide
|
|||||
| Light Chain Sequence |
DIVMTQSPDSLAVSLGERATINCKSSQSLLNSGNQKNYLTWYQQKPGQPPKLLIYWASTR
ESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQNAYSFPWTFGQGTKVEIK Click to Show/Hide
|
|||||
| Light Chain CDR 1 |
KSSQSLLNSGNQKNYLT
Click to Show/Hide
|
|||||
| Light Chain CDR 2 |
WASTRES
Click to Show/Hide
|
|||||
| Light Chain CDR 3 |
QNAYSFPWT
Click to Show/Hide
|
|||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
CM311-18D10-VH6/VL1-ADC [Investigative]
Discovered Using Patient-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth lnhibition value (TGl) |
64.40%
|
High Claudin 18.2 expression (Claudin 18.2 +++) | ||
| Method Description |
Patient-derived Xenograft Model were established by tumor tissue with a volume of about 15-30 mm3 was transplanted into the back of BALB/c nude mice subcutaneously, and treatment with 1mg/kg ADCs when the tumor volume reached 150-260 mm3.
|
||||
| In Vivo Model | STO #523 patient-derived xenograft model | ||||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth lnhibition value (TGl) |
0.70%
|
High Claudin 18.2 expression (Claudin 18.2 +++) | ||
| Method Description |
Patient-derived Xenograft Model were established by tumor tissue with a volume of about 15-30 mm3 was transplanted into the back of BALB/c nude mice subcutaneously, and treatment with 1mg/kg ADCs when the tumor volume reached 150-260 mm3.
|
||||
| In Vivo Model | STO #025 patient-derived xenograft model | ||||
| Experiment 3 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth lnhibition value (TGl) |
93.21%
|
High Claudin 18.2 expression (Claudin 18.2 +++) | ||
| Method Description |
Patient-derived Xenograft Model were established by tumor tissue with a volume of about 15-30 mm3 was transplanted into the back of BALB/c nude mice subcutaneously, and treatment with 3mg/kg ADCs when the tumor volume reached 150-260 mm3.
|
||||
| In Vivo Model | STO #523 patient-derived xenograft model | ||||
| Experiment 4 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth lnhibition value (TGl) |
100%
|
High Claudin 18.2 expression (Claudin 18.2 +++) | ||
| Method Description |
Patient-derived Xenograft Model were established by tumor tissue with a volume of about 15-30 mm3 was transplanted into the back of BALB/c nude mice subcutaneously, and treatment with 3mg/kg ADCs when the tumor volume reached 150-260 mm3.
|
||||
| In Vivo Model | STO #025 patient-derived xenograft model | ||||
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
113.8 ng/mL
|
High Claudin 18.2 expression (Claudin 18.2 +++) | ||
| Method Description |
LI-M11 cells at 5000 cells/well, 1.2mg/ml ADCs were added and incubated for 96 hours, then CCK-8 or Presto-Blue detection reagent was added to each well, and a microplate reader was used for detection and four parameter fitting was carried out.
|
||||
| In Vitro Model | Lung lymphangioleiomyomatosis, Lymphangioleiomyomatosis | LI-M11 cells | CVCL_8891 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
253.9 ng/mL
|
Moderate Claudin 18.2 expression (Claudin 18.2++) | ||
| Method Description |
LT-1C8 at 5000 or 10000 cells/well, 1.2mg/ml ADCs were added and incubated for 96 hours, then CCK-8 or Presto-Blue detection reagent was added to each well, and a microplate reader was used for detection and four parameter fitting was carried out.
|
||||
| In Vitro Model | Lung lymphangioleiomyomatosis, Lymphangioleiomyomatosis | LT-1C8 cells | CVCL_8891 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
4632 ng/mL
|
Negative Claudin 18.2 expression (Claudin 18.2-) | ||
| Method Description |
BxPC-3 at 3000 cells/well, 1.2mg/ml ADCs were added and incubated for 96 hours, then CCK-8 or Presto-Blue detection reagent was added to each well, and a microplate reader was used for detection and four parameter fitting was carried out.
|
||||
| In Vitro Model | Pancreatic ductal adenocarcinoma | BxPC-3 cells | CVCL_0186 | ||
| Experiment 4 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
16.37 ng/mL
|
High Claudin 18.2 expression (Claudin 18.2 +++) | ||
| Method Description |
KATO III cell line was plated at 5000 cells/well, and the samples were added 24 hours later. All samples to be tested were diluted 2.4 folds starting from a final concentration of 1000 ng/mL for 9 times and incubated for 96 hours, and the fluorescence intensity was read by a microplate reader after color development for 60 min with PrestoBlue.
|
||||
| In Vitro Model | Down syndrome | KATO III cells | CVCL_0371 | ||
