General Information of This Antibody (ID: ANTI0CGLJV)
Antibody Name
CM311-18D10-VH6/VL1
Organization
SHANGHAI MIRACOGEN INC. | KEYMED BIOSCIENCES CO., LTD
Synonyms
h18D10.v26
   Click to Show/Hide
Antibody Type
Monoclonal antibody (mAb)
Antibody Subtype
Humanized lgG
Antigen Name
Claudin-18.2 (CLDN18.2)
 Antigen Info 
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence
QVQLQESGPGLVKPSETLSLTCTVSGGSISSNYAWNWIRQPPGKGLEWIGYIYYSGNTNY
NPSLKSRVTISRDTSKNQFSLKLSSVTAADTAVYYCATSYYGNSFIYWGQGTLVTVSS
    Click to Show/Hide
Heavy Chain CDR 1
GGSISSNYAWN
    Click to Show/Hide
Heavy Chain CDR 2
YIYYSGNTNYNPSLKS
    Click to Show/Hide
Heavy Chain CDR 3
SYYGNSFIY
    Click to Show/Hide
Light Chain Sequence
DIVMTQSPDSLAVSLGERATINCKSSQSLLNSGNQKNYLTWYQQKPGQPPKLLIYWASTR
ESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQNAYSFPWTFGQGTKVEIK
    Click to Show/Hide
Light Chain CDR 1
KSSQSLLNSGNQKNYLT
    Click to Show/Hide
Light Chain CDR 2
WASTRES
    Click to Show/Hide
Light Chain CDR 3
QNAYSFPWT
    Click to Show/Hide
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
CM311-18D10-VH6/VL1-ADC [Investigative]
Discovered Using Patient-derived Xenograft Model
Click To Hide/Show 4 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth lnhibition value (TGl)
64.40%
High Claudin 18.2 expression (Claudin 18.2 +++)
Method Description
Patient-derived Xenograft Model were established by tumor tissue with a volume of about 15-30 mm3 was transplanted into the back of BALB/c nude mice subcutaneously, and treatment with 1mg/kg ADCs when the tumor volume reached 150-260 mm3.
In Vivo Model STO #523 patient-derived xenograft model
Experiment 2 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth lnhibition value (TGl)
0.70%
High Claudin 18.2 expression (Claudin 18.2 +++)
Method Description
Patient-derived Xenograft Model were established by tumor tissue with a volume of about 15-30 mm3 was transplanted into the back of BALB/c nude mice subcutaneously, and treatment with 1mg/kg ADCs when the tumor volume reached 150-260 mm3.
In Vivo Model STO #025 patient-derived xenograft model
Experiment 3 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth lnhibition value (TGl)
93.21%
High Claudin 18.2 expression (Claudin 18.2 +++)
Method Description
Patient-derived Xenograft Model were established by tumor tissue with a volume of about 15-30 mm3 was transplanted into the back of BALB/c nude mice subcutaneously, and treatment with 3mg/kg ADCs when the tumor volume reached 150-260 mm3.
In Vivo Model STO #523 patient-derived xenograft model
Experiment 4 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth lnhibition value (TGl)
100%
High Claudin 18.2 expression (Claudin 18.2 +++)
Method Description
Patient-derived Xenograft Model were established by tumor tissue with a volume of about 15-30 mm3 was transplanted into the back of BALB/c nude mice subcutaneously, and treatment with 3mg/kg ADCs when the tumor volume reached 150-260 mm3.
In Vivo Model STO #025 patient-derived xenograft model
Revealed Based on the Cell Line Data
Click To Hide/Show 4 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
113.8 ng/mL
High Claudin 18.2 expression (Claudin 18.2 +++)
Method Description
LI-M11 cells at 5000 cells/well, 1.2mg/ml ADCs were added and incubated for 96 hours, then CCK-8 or Presto-Blue detection reagent was added to each well, and a microplate reader was used for detection and four parameter fitting was carried out.
In Vitro Model Lung lymphangioleiomyomatosis, Lymphangioleiomyomatosis LI-M11 cells CVCL_8891
Experiment 2 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
253.9 ng/mL
Moderate Claudin 18.2 expression (Claudin 18.2++)
Method Description
LT-1C8 at 5000 or 10000 cells/well, 1.2mg/ml ADCs were added and incubated for 96 hours, then CCK-8 or Presto-Blue detection reagent was added to each well, and a microplate reader was used for detection and four parameter fitting was carried out.
In Vitro Model Lung lymphangioleiomyomatosis, Lymphangioleiomyomatosis LT-1C8 cells CVCL_8891
Experiment 3 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
4632 ng/mL
Negative Claudin 18.2 expression (Claudin 18.2-)
Method Description
BxPC-3 at 3000 cells/well, 1.2mg/ml ADCs were added and incubated for 96 hours, then CCK-8 or Presto-Blue detection reagent was added to each well, and a microplate reader was used for detection and four parameter fitting was carried out.
In Vitro Model Pancreatic ductal adenocarcinoma BxPC-3 cells CVCL_0186
Experiment 4 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Effective Concentration (EC50)
16.37 ng/mL
High Claudin 18.2 expression (Claudin 18.2 +++)
Method Description
KATO III cell line was plated at 5000 cells/well, and the samples were added 24 hours later. All samples to be tested were diluted 2.4 folds starting from a final concentration of 1000 ng/mL for 9 times and incubated for 96 hours, and the fluorescence intensity was read by a microplate reader after color development for 60 min with PrestoBlue.
In Vitro Model Down syndrome KATO III cells CVCL_0371
References
Ref 1 Antibody-drug conjugate and application thereof