Antibody Information
General Information of This Antibody (ID: ANTI0CBLIG)
| Antibody Name | CR014 |
|||||
|---|---|---|---|---|---|---|
| Antigen Name | TIM1 |
Antigen Info | ||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Sequence |
MEFGLSWLFLVAILKGVQCQVQLVESGGGVVQPGRSLRLSCAASGFIFSRYGMHWVRQAP
GKGLKWVAVIWYDGSNKLYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDYY DNSRHHWGFDYWGQGTLVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVT VSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRV ESKYGPPCPSCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWY VDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISK AKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVL DSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK Click to Show/Hide
|
|||||
| Heavy Chain Varible Domain |
MEFGLSWLFLVAILKGVQCQVQLVESGGGVVQPGRSLRLSCAASGFIFSRYGMHWVRQAP
GKGLKWVAVIWYDGSNKLYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDYY DNSRHHWGFDYWGQGTLVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVT VSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRV ESKYGPPCPSCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWY VDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISK AKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVL DSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK Click to Show/Hide
|
|||||
| Light Chain Sequence |
METPAQLLFLLLLWLPDTTGDIVMTQTPLSLPVTPGEPASISCRSSRSLLDSDDGNTYLD
WYLQKPGQSPQLLIYTLSYRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQRVEF PITFGQGTRLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNAL QSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Click to Show/Hide
|
|||||
| Light Chain Varible Domain |
METPAQLLFLLLLWLPDTTGDIVMTQTPLSLPVTPGEPASISCRSSRSLLDSDDGNTYLD
WYLQKPGQSPQLLIYTLSYRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQRVEF PITFGQGTRLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNAL QSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Click to Show/Hide
|
|||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
CDX-014 [Phase 1 (discontinued)]
Identified from the Human Clinical Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Patients Enrolled |
Eligible patients must have advanced/metastatic clear cell/papillary renal cell carcinoma (RCC; ≥2 prior therapies including VEGF-TKI) or clear cell ovarian carcinoma (OCCC; ≥1 platinum-taxane regimen), measurable disease, life expectancy ≥3 months, and available TIM-1-expressing tumor tissue. Key exclusions: prior MMAE therapy, recent cytotoxic/TKI/mAb treatments (within 2-4 weeks), uncontrolled comorbidities, active infections (excluding oral-therapy-controlled cases), untreated brain metastases, significant cardiovascular disease, concurrent malignancies (except cured skin/in situ cancers), and chronic high-dose corticosteroid use (>5mg prednisone/day). Effective contraception is mandatory during and for 6 months post-treatment.
Click to Show/Hide
|
||||
| Administration Dosage |
During the treatment phase of the study, patients will receive CDX-014 treatment every 3 weeks (RCC or OCCC) or every 2 weeks (RCC) as long as they remain eligible. Patients may be discontinued from CDX-014 treatment based on the results of disease assessments or if experiencing side effects that make study therapy intolerable.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT02837991 | Clinical Status | PHASE1 | ||
| Clinical Description |
A Phase l Open-Label, Dose Escalation and Cohort Expansion Study, to Assess the Safety and Activity of the Antibody-Drug Conjugate CDX-014 in Advanced or Metastatic Renal Cell Carcinoma (RCC) and Advanced or Metastatic Ovarian Clear Cell Carcinoma (OCCC)
|
||||
| Primary Endpoint |
The dose escalation phase aims to determine the maximum tolerated dose (MTD) and recommended phase II dose (RP2D) of CDX-014, defined as the highest dose with <33% incidence of dose-limiting toxicities (DLTs) within 21 days post-first dose. The expansion cohort will evaluate objective response rate (ORR) per RECIST v1.1, assessed every 6-9 weeks until discontinuation or progression (up to 5 years).
Click to Show/Hide
|
||||
| Experiment 2 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Partial Response (PR) |
6.20%
|
|||
| Patients Enrolled |
Advanced clear cell or papillary renal cell carcinoma (RCC) who experienced progression after at least two lines of systemic therapy, including at least one TKI were included; Additional main inclusion criteria included measurable disease by Response Criteria in Solid Tumors (RECIST) 1.1 criteria, a Karnofsky performance status 70%, and adequate renal, hepatic, and hematological laboratory values.
Click to Show/Hide
|
||||
| Administration Dosage |
Intravenously at doses ranging from 0.15 to 2.00 mg/kg every 2 or 3 weeks until progression or unacceptable toxicity.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT02837991 | Clinical Status | Phase 1 | ||
| Clinical Description |
A phase l open-label, dose escalation and cohort expansion study, to assess the safety and activity of the antibody-drug conjugate CDX-014 in advanced or metastatic renal cell carcinoma (RCC) and advanced or metastatic ovarian clear cell carcinoma (OCCC).
|
||||
| Primary Endpoint |
One patient (6.20%) treated at 0.3 mg/kg every 3 weeks exhibited PR as best overall response,ongoing after 17 months on therapy; this patient had been on single agent PD-1 inhibition prior to initiating therapy with CDX-014. Five patients (31.00%) exhibited clinical benefit from CDX-014. PFS and OS were 2.70 months (95%CI 1.2-8.0) and 12.6 months (95%CI 5.7-12.6),respectively.
Click to Show/Hide
|
||||
| Other Endpoint |
Partial response (PR) = 6.00% of one patient treated at 0.30 mg/kg every 3 weeks as best overall response, clinical benefit from CDX-014 of five patients = (31.25%) exhibited of at least 6 months. PFS = 2.7 months (95%CI, 1.20-8.00) ,OS =12.6 months (95%CI, 5.70-12.60).
|
||||
Discovered Using Cell Line-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 20% | Positive TIM1 expression (TIM1+++/++) | ||
| Method Description |
Anti-TIM-1-vcMMAE (CDX-014=300 g), CDX-014 inhibited the increase in tumor volumes relative to saline control treatment.
|
||||
| In Vivo Model | IGROV-1 xenograft mouse models | ||||
| In Vitro Model | Ovarian endometrioid adenocarcinoma | IGROV-1 cells | CVCL_1304 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 21% | Positive TIM1 expression (TIM1+++/++) | ||
| Method Description |
Anti-TIM-1-vcMMAE (CDX-014=300 g).
|
||||
| In Vivo Model | A549 xenograft mouse models | ||||
| In Vitro Model | Lung adenocarcinoma | A-549 cells | CVCL_0023 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 22.90% | Positive TIM1 expression (TIM1+++/++) | ||
| Method Description |
Anti-TIM-1-vcMMAE (CDX-014=300 g).
|
||||
| In Vivo Model | Caki-1 xenograft mouse model | ||||
| In Vitro Model | Clear cell renal cell carcinoma | Caki-1 cells | CVCL_0234 | ||
| Experiment 4 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 40.50% | Positive TIM1 expression (TIM1+++/++) | ||
| Method Description |
Extended dosing of CDX-014 ADC in the A549 tumor model. Three cycles of four doses of CDX-014 prolong the inhibition of tumor growth.
|
||||
| In Vivo Model | A549 xenograft mouse models | ||||
| In Vitro Model | Lung adenocarcinoma | A-549 cells | CVCL_0023 | ||
References
