General Information of This Antibody (ID: ANTI0BQFXW)
Antibody Name
huDS6
Antigen Name
Carbonic anhydrase 6 (CA6)
 Antigen Info 
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence
QAQLVQSGAEVVKPGASVKMSCKASGYTFTSYNMHWVKQTPGQGLEWIGYIYPGNGATNY
NQKFQGKATLTADTSSSTAYMQISSLTSEDSAVRFCARGDSVPFAYWGQGTLVTVSAAST
KGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLY
SLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSV
FLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTY
RVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTK
NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG
NVFSCSVMHEALHNHYTQKSLSLSPGK
    Click to Show/Hide
Heavy Chain Varible Domain
QAQLVQSGAEVVKPGASVKMSCKASGYTFTSYNMHWVKQTPGQGLEWIGYIYPGNGATNY
NQKFQGKATLTADTSSSTAYMQISSLTSEDSAVRFCARGDSVPFAYWGQGTLVTVSAAST
KGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLY
SLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSV
FLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTY
RVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTK
NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG
NVFSCSVMHEALHNHYTQKSLSLSPGK
    Click to Show/Hide
Light Chain Sequence
EIVLTQSPATMSASPGERVTITCSAHSSVSFMHWFQQKPGTSPKLWIYSTSSLASGVPAR
FGGSGSGTSYSLTISSMEAEDAATYYCQQRSSFPLTFGAGTKLELKRTVAAPSVFIFPPS
DEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTL
SKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
    Click to Show/Hide
Light Chain Varible Domain
EIVLTQSPATMSASPGERVTITCSAHSSVSFMHWFQQKPGTSPKLWIYSTSSLASGVPAR
FGGSGSGTSYSLTISSMEAEDAATYYCQQRSSFPLTFGAGTKLELKRTVAAPSVFIFPPS
DEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTL
SKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
    Click to Show/Hide
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
SAR566658 [Phase 2 (discontinued)]
Identified from the Human Clinical Data
Click To Hide/Show 4 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Patients Enrolled
Eligibility: Metastatic TNBC patients (&ge;18y, ECOG<2) with CA6-positive disease and 1-3 prior chemotherapy lines (must include anthracycline/taxane). Exclusions: active CNS metastases, prior maytansinoid/eribulin therapy, Grade &ge;2 neuropathy, corneal disorders, CYP3A4 inhibitor use, or contraindications to ocular prophylaxis. Contraception required during/6 months post-treatment.

   Click to Show/Hide
Administration Dosage
Participants received SAR566658 90 milligram per square meter (mg/m^2) as intravenous infusion on Day 1 and Day 8 of each 21-day treatment cycle (maximum number of cycles received was 3).
Related Clinical Trial
NCT Number NCT02984683  Clinical Status PHASE2
Clinical Description
Open-label Phase 2 Study Evaluating Efficacy and Safety of SAR566658 Treatment in Patients With CA6 Positive Metastatic Triple Negative Breast Cancer
Primary Endpoint
Primary endpoints include IMP-related safety findings (Grade ≥3 eye disorders/peripheral neuropathy or Grade ≥4 TEAEs per NCI CTCAE v4.03) during Cycle 1-2 (21-day cycles) and objective response rate (CR+PR per RECIST 1.1) assessed every 6 weeks until progression.
Other Endpoint
Secondary outcomes comprise disease control rate (CR+PR+SD≥3 months), duration of response, PFS, TTP, treatment-emergent AEs/SAEs up to 30 days post-treatment, keratopathies incidence (with prophylactic ocular measures), and anti-drug antibody development over 3 treatment cycles.
Experiment 2 Reporting the Activity Date of This ADC [2]
Patients Enrolled
Eligibility: CA6-positive solid tumor patients (&ge;15% tumor cell staining) without standard therapy options. Exclusions: ECOG&ge;2, organ dysfunction, unresolved toxicities (Grade>1), recent antitumor therapy (<3 weeks washout), pulmonary/cardiac comorbidities, corneal disorders, CYP3A inhibitor use, or midazolam contraindications (for specific cohort). Contraception required.

   Click to Show/Hide
Administration Dosage
SAR566658 will be administered by intravenous (IV) infusion according to three different schedules
Related Clinical Trial
NCT Number NCT01156870  Clinical Status PHASE1
Clinical Description
Dose Escalation, Safety and Pharmacokinetic, First in Man Study, of SAR566658 Administered as a Single Agent by Intravenous Infusion in Adult Patients With CA6-Positive and Refractory Solid Tumors
Primary Endpoint
Primary objectives include dose escalation to determine MTD of SAR566658 (3-week cycles) and evaluation of preliminary antitumor activity (assessed every 6 weeks), along with CYP3A enzyme interaction assessment using midazolam probe at Days 1 and 4.
Other Endpoint
Secondary endpoints comprise comprehensive safety monitoring (NCI-CTCAE v4.03), PK profiling, immunogenicity assessment, antitumor response evaluation, CYP3A activity analysis (up to Cycle 2), and alternative dosing schedule safety (up to 2 years).
Experiment 3 Reporting the Activity Date of This ADC [3]
Related Clinical Trial
NCT Number NCT02984683  Clinical Status Phase 1
Clinical Description
Open-label phase 2 study evaluating efficacy and safety of SAR566658 treatment in patients with CA6 positive metastatic triple negative breast cancer.
Experiment 4 Reporting the Activity Date of This ADC [4]
Related Clinical Trial
NCT Number NCT01156870  Clinical Status Phase 1
Clinical Description
Dose escalation, safety and pharmacokinetic, first in man study, of SAR566658 administered as a single agent by intravenous infusion in adult patients with CA6-positive and refractory solid tumors.
References
Ref 1 Study Evaluating Efficacy and Safety of SAR566658 Treatment in Patients With CA6 Positive Metastatic Triple Negative Breast Cancer
Ref 2 First in Man Study of SAR566658 Administered in Patients With CA6-Positive and Refractory Solid Tumor
Ref 3 Open-label Phase 2 Study Evaluating Efficacy and Safety of SAR566658 Treatment in Patients With CA6 Positive Metastatic Triple Negative Breast Cancer
Ref 4 Dose Escalation, Safety and Pharmacokinetic, First in Man Study, of SAR566658 Administered as a Single Agent by Intravenous Infusion in Adult Patients With CA6-Positive and Refractory Solid Tumors