General Information of This Antibody (ID: ANTI0AUCKL)
Antibody Name
A humanized anti-CDH6 IgG1 mAb
Antigen Name
Cadherin-6 (CDH6)
 Antigen Info 
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFTFTTYAMNWVRQAPGKGLEWVARIRIKNNNYAT
YYADSVTDRFTISRDDSKNSLYLQMNSLKTEDTAVYYCVPDYNGYGLAYWGQGTLVTVSS
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS
GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGG
PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN
STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDE
LTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW
QQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    Click to Show/Hide
Light Chain Sequence
DIQLTQSPSSLSASVGDRVTITCSASSISSNYLYHWYQQKPGKSPKLLIYRSFYLASGVP
SRFSGSGSGTDFTLTISSLQPEDFATYYCQQDIVPLTFGQGTKLEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
    Click to Show/Hide
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
AMT-707 [Phase 1]
Identified from the Human Clinical Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Patients Enrolled
Eligible patients (&ge;18 years) with advanced solid tumors after prior therapy provide informed consent, have measurable disease (RECIST 1.1), ECOG 0-1, and adequate organ function (ANC &ge;1.5x10<sup>9</sup>/L, platelets &ge;100x10<sup>9</sup>/L, hemoglobin &ge;9.0g/dL, CrCl &ge;45mL/min, LVEF &ge;50%). Exclusion criteria: prior TOP1-ADC treatment, active brain metastases, unresolved Grade >1 toxicities, recent systemic therapy/radiation/surgery, significant cardiac/liver disease, infections (HIV/HBV/HCV under control allowed), pregnancy, or concurrent clinical trials.

   Click to Show/Hide
Related Clinical Trial
NCT Number NCT06234423  Clinical Status PHASE1
Clinical Description
A Phase 1, First-in-Human Study of CUSP06, a Cadherin-6 (CDH6)-directed Antibody-Drug Conjugate, in Patients with Platinum-Refractory/Resistant Ovarian Cancer and Other Advanced Solid Tumors
Primary Endpoint
Phase 1a and 1b evaluate the safety and tolerability of CUSP06 over 36 months, recording adverse events (AEs), serious adverse events (SAEs), dose interruptions, and reductions per NCI CTCAE v5.0, while Phase 1a determines the recommended dose for expansion (RDE) within 15 months. In Phase 1b, preliminary efficacy is assessed via RECIST 1.1, measuring the overall response rate (ORR) over 16 months, defined as confirmed partial (PR) or complete responses (CR).

   Click to Show/Hide
Other Endpoint
CUSP06's pharmacokinetics (PK) are evaluated, including maximum concentration (Cmax), time to Cmax (Tmax), area under the curve (AUC), and terminal half-life (t1/2) over 36 months. Efficacy metrics include RECIST 1.1-defined ORR (18 months), disease control rate (DCR), clinical benefit rate (CBR), duration of response (DoR), time to progression (TTP), progression-free survival (PFS), overall survival (OS), and PRROC patients' CA-125 reduction ≥50% (36 months). Immunogenicity is also assessed via antidrug antibodies (ADAs).

   Click to Show/Hide
References
Ref 1 A Study of CUSP06 in Patients with Platinum-Refractory/Resistant Ovarian Cancer and Other Advanced Solid Tumors