Antibody Information
General Information of This Antibody
| Antibody ID | ANTI0ADFQO |
|||||
|---|---|---|---|---|---|---|
| Antibody Name | Trz-LC:p67 |
|||||
| Organization | Technical University of Darmstadt. |
|||||
| Synonyms |
Trz-LC:p67
Click to Show/Hide
|
|||||
| Antibody Type | Fusion protein (FP) |
|||||
| Antigen Name | Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
Antigen Info | ||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Sequence |
EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVARIYPTNGYTRY
ADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSS ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPPKSCDKTHTCPPCPAPELLG GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRD ELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR WQQGNVFSCSVMHEALHNHYTQKSLSLSPG Click to Show/Hide
|
|||||
| Light Chain Sequence |
DIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYSASFLYSGVPS
RFSGSRSGTDFTLTISSLQPEDFATYYCQQHYTTPPTFGQGTKVEIKRTVAAPSVFIFPP SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT LSKADYEKHKVYACEVTHQGLSSVTKSFNRGECGGGGSGGGGSGGGGSLRSPMPGVVVAV SVKPGDAVAEGQEICVIEAMKMQNSMTAGKTGTVKSVHCQAGDTVGEGDLLVELE Click to Show/Hide
|
|||||
The Activity Data of This Antibody
| Antibody Activity Information 1 | [1] | |||||
|
Half Maximal Effective Concentration (EC50)
|
2.6
|
nM
|
SK-BR-3 cells | CVCL_0033 | ||
|---|---|---|---|---|---|---|
| Antigen Expression | Positive HER2 expression (HER2+++/++) | |||||
| Antibody Function | Trz-LC:p67 bound to SK-BR-3 cells | |||||
| Antibody Antigen Binding Assay | EC50 values derived from cellular binding assays on SK-BR-3 cells. | |||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
Trz-LC:p67-MMAE [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
2 nM
|
Positive HER2 expression (HER2+++/++) | ||
| Method Description |
6000 cells/well were seeded in a U bottom 96 well plate in 90 uL of medium (Table S 2) and incubated over night at 37 °C and 5% CO2. Jurkat cells utilized for this assay were derived from mechanism-of-action (MOA)-based bioassay core kit to measure FcGammaRIIIa (V158) function (Promega GmbH, Walldorf, Germany). The next day, 10 uL of a dilution row of each sample was added and cells were incubated for 3 days at 37°C and 5% CO2. To evaluate viability, cellular viability assay was performed utilizing CellTiter-Blue® (Promega GmbH, Walldorf, Germany) following the instructions if the supplier. Fluorescence measurement was conducted with a CLARIOstar Plus (BMG Labtech, Ortenberg, Germany) plate reader. Experiments with SKBR3, A431 and Ramos were conducted in at least two biological replicates with three technical replicates each. Assays on Jurkat cells were performed in technical triplicates.
Click to Show/Hide
|
||||
| In Vitro Model | Breast adenocarcinoma | SK-BR-3 cells | CVCL_0033 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
7.2 nM
|
Low HER2 expression (HER2+) | ||
| Method Description |
6000 cells/well were seeded in a U bottom 96 well plate in 90 uL of medium (Table S 2) and incubated over night at 37 °C and 5% CO2. Jurkat cells utilized for this assay were derived from mechanism-of-action (MOA)-based bioassay core kit to measure FcGammaRIIIa (V158) function (Promega GmbH, Walldorf, Germany). The next day, 10 uL of a dilution row of each sample was added and cells were incubated for 3 days at 37°C and 5% CO2. To evaluate viability, cellular viability assay was performed utilizing CellTiter-Blue® (Promega GmbH, Walldorf, Germany) following the instructions if the supplier. Fluorescence measurement was conducted with a CLARIOstar Plus (BMG Labtech, Ortenberg, Germany) plate reader. Experiments with SKBR3, A431 and Ramos were conducted in at least two biological replicates with three technical replicates each. Assays on Jurkat cells were performed in technical triplicates.
Click to Show/Hide
|
||||
| In Vitro Model | Skin squamous cell carcinoma | A431 cells | CVCL_0037 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
7.6 nM
|
Negative HER2 expression (HER2-) | ||
| Method Description |
6000 cells/well were seeded in a U bottom 96 well plate in 90 uL of medium (Table S 2) and incubated over night at 37 °C and 5% CO2. Jurkat cells utilized for this assay were derived from mechanism-of-action (MOA)-based bioassay core kit to measure FcGammaRIIIa (V158) function (Promega GmbH, Walldorf, Germany). The next day, 10 uL of a dilution row of each sample was added and cells were incubated for 3 days at 37°C and 5% CO2. To evaluate viability, cellular viability assay was performed utilizing CellTiter-Blue® (Promega GmbH, Walldorf, Germany) following the instructions if the supplier. Fluorescence measurement was conducted with a CLARIOstar Plus (BMG Labtech, Ortenberg, Germany) plate reader. Experiments with SKBR3, A431 and Ramos were conducted in at least two biological replicates with three technical replicates each. Assays on Jurkat cells were performed in technical triplicates.
Click to Show/Hide
|
||||
| In Vitro Model | Adenocarcinoma of the rat mammary gland | Jurkat Fc-GammaIIIa++ cells | CVCL_3475 | ||
References
