Antibody Information
General Information of This Antibody
| Antibody ID | ANI0WKBSB |
|||||
|---|---|---|---|---|---|---|
| Antibody Name | MFRF3266A |
|||||
| Antibody Type | Monoclonal antibody (mAb) |
|||||
| Antibody Subtype | Humanized IgG1-kappa |
|||||
| Antigen Name | Fc receptor-like protein 5 (FCRL5) |
Antigen Info | ||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Sequence |
EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAVSWVRQAPGKGLEWVATISSGGSLTFY
LDSVRGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARPIPDYYALDYWGQGTLVTVSS Click to Show/Hide
|
|||||
| Light Chain Sequence |
DIQMTQSPSSLSASVGDRVTITCKASQDVSTAVAWYQQKPGKAPKLLIYSASYRYTGVPS
RFSGSGSGTDFTLTISSLQPEDFATYYCQQHFSSPRTFGQGTKVEIKR Click to Show/Hide
|
|||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
RG7598 [Phase 1 (discontinued)]
Identified from the Human Clinical Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Patients Enrolled |
Eligibility requires adults (≥18) with ECOG 0-2, relapsed/refractory myeloma (prior proteasome inhibitor/immunomodulatory therapy), and measurable disease. Exclusions: recent mAb/chemotherapy (≤4/2 weeks), unresolved toxicities (except neuropathy), recent transplants, antibody allergies, active infections, or hepatitis/HIV. Pregnancy is prohibited.
Click to Show/Hide
|
||||
| Administration Dosage |
multiple ascending doses
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT01432353 | Clinical Status | PHASE1 | ||
| Clinical Description |
An Open-label, Multicenter, Phase I Trial of the Safety and Pharmacokinetics of Escalating Doses of DFRF4539A in Patients With Relapsed or Refractory Multiple Myeloma
|
||||
| Primary Endpoint |
The study evaluates safety outcomes including AE incidence over 3.5 years, MTD/DLT determination within 1.5 years, and establishes the RP2D for DFRF4539A administered every 3 weeks or weekly.
|
||||
| Other Endpoint |
Immunogenicity (serum ATA levels) and PK (AUC) are monitored over 3.5 years. Efficacy is assessed via IMWG/EBMT criteria for objective response, DoR (time to progression/death), and PFS (from treatment initiation to progression/death within 30 days post-treatment).
|
||||
References