General Information of This Antibody (ID: ANI0WKBSB)
Antibody Name
MFRF3266A
Antibody Type
Monoclonal antibody (mAb)
Antibody Subtype
Humanized IgG1-kappa
Antigen Name
Fc receptor-like protein 5 (FCRL5)
 Antigen Info 
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAVSWVRQAPGKGLEWVATISSGGSLTFY
LDSVRGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARPIPDYYALDYWGQGTLVTVSS
    Click to Show/Hide
Light Chain Sequence
DIQMTQSPSSLSASVGDRVTITCKASQDVSTAVAWYQQKPGKAPKLLIYSASYRYTGVPS
RFSGSGSGTDFTLTISSLQPEDFATYYCQQHFSSPRTFGQGTKVEIKR
    Click to Show/Hide
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
RG7598 [Phase 1 (discontinued)]
Identified from the Human Clinical Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Patients Enrolled
Eligibility requires adults (≥18) with ECOG 0-2, relapsed/refractory myeloma (prior proteasome inhibitor/immunomodulatory therapy), and measurable disease. Exclusions: recent mAb/chemotherapy (≤4/2 weeks), unresolved toxicities (except neuropathy), recent transplants, antibody allergies, active infections, or hepatitis/HIV. Pregnancy is prohibited.

   Click to Show/Hide
Administration Dosage
multiple ascending doses
Related Clinical Trial
NCT Number NCT01432353  Clinical Status PHASE1
Clinical Description
An Open-label, Multicenter, Phase I Trial of the Safety and Pharmacokinetics of Escalating Doses of DFRF4539A in Patients With Relapsed or Refractory Multiple Myeloma
Primary Endpoint
The study evaluates safety outcomes including AE incidence over 3.5 years, MTD/DLT determination within 1.5 years, and establishes the RP2D for DFRF4539A administered every 3 weeks or weekly.
Other Endpoint
Immunogenicity (serum ATA levels) and PK (AUC) are monitored over 3.5 years. Efficacy is assessed via IMWG/EBMT criteria for objective response, DoR (time to progression/death), and PFS (from treatment initiation to progression/death within 30 days post-treatment).
References
Ref 1 Phase I study of the anti-FcRH5 antibody-drug conjugate DFRF4539A in relapsed or refractory multiple myeloma