General Information of This Antibody
Antibody ID
ANI0UYOXH
Antibody Name
Anti-GPC1 GPC1-ADC (MMAE) mAb
Synonyms
Anti-GPC1 GPC1-ADC(MMAE) mAb; 01a033
   Click to Show/Hide
Antibody Type
Monoclonal antibody (mAb)
Antibody Subtype
Humanized IgG1-kappa
Antigen Name
Glypican-1 (GPC1)
 Antigen Info 
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence
MKHLWFFLLLVAAPRWVLSQVQLKQSGPELVKPGASVKISCKASGYSFTGYYMHWVKQSP
EKSLEWIGEINPSTGDTTYNQKFKAKATLTVDKSSSTAYMQLKSLTSEDSAVYYCAREKR
DDGVFAYWGQGTLVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWN
SGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGP
TIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFV
NNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKP
KGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLD
SDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK
    Click to Show/Hide
Light Chain Sequence
MRLLAQLLGLLMLWVPGSSGDIVMSQSPKSMSMSVGERVALSCKASENVGTYVSWYQQKP
EQSPKLLIYGASNRYTGVPDRFTGSGSATDFTLTISSVQAEDLADYYCGQSYSYPLTFGA
GTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVL
NSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
    Click to Show/Hide
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
GPC1-ADC-MMAE [Investigative]
Discovered Using Patient-derived Xenograft Model
Click To Hide/Show 2 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 88.80% (Day 35) High GPC1 expression (GPC1+++)
In Vivo Model Pancreatic cancer PDX model (PDX: PK645)
Experiment 2 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 98.70% (Day 28) High GPC1 expression (GPC1+++)
In Vivo Model Pancreatic cancer PDX model (PDX: PK565)
Revealed Based on the Cell Line Data
Click To Hide/Show 3 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
80.90 pM
High GPC1 expression (GPC1+++)
Method Description
GPC1-ADC(MMAE) induces efficient tumor cell killing in cells PDX models from a Pancreatic ductal adenocarcinoma (PDAC) patient with GPC1 expression.
In Vitro Model Pancreatic carcinoma KP-2 cells CVCL_3004
Experiment 2 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
0.55 nM
High GPC1 expression (GPC1+++)
Method Description
GPC1-ADC(MMAE) induces efficient tumor cell killing in cells PDX models from a Pancreatic ductal adenocarcinoma (PDAC) patient with GPC1 expression.
In Vitro Model Pancreatic ductal adenocarcinoma PK-8 cells CVCL_4718
Experiment 3 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
0.68 nM
High GPC1 expression (GPC1+++)
Method Description
GPC1-ADC(MMAE) induces efficient tumor cell killing in cells PDX models from a Pancreatic ductal adenocarcinoma (PDAC) patient with GPC1 expression.
In Vitro Model Pancreatic ductal adenocarcinoma BxPC-3 cells CVCL_0186
References
Ref 1 Glypican-1 Is a Novel Target for Stroma and Tumor Cell Dual-Targeting Antibody-Drug Conjugates in Pancreatic Cancer. Mol Cancer Ther. 2021 Dec;20(12):2495-2505.

If you find any error in data or bug in web service, please kindly report it to Dr. Shen et al.