General Information of This Antibody (ID: ANI0UCSDQ)
Antibody Name
CQY684
Antibody Type
Monoclonal antibody (mAb)
Antibody Subtype
Humanized IgG1-kappa
Antigen Name
Cadherin-3 (CDH3)
 Antigen Info 
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence
QVQLQQSGPGLVKPSQTLSLTCAISGDSVSSQSAAWNWIRQSPSRGLEWLGRIYYRSKWY
NDYALSVKSRITINPDTSKNQFSLQLNSVTPEDTAVYYCARGEGYGREGFAIWGQGTLVT
VSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVL
QSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSEFDYKDDDDKGAPHH
HHHH
    Click to Show/Hide
Light Chain Sequence
DIQMTQSPSSLSASVGDRVTITCRASQTISNTLAWYQQKPGKAPKLLIYAASNLQSGVPS
RFSGSGSGTDFTLTISSLQPEDFATYYCQQYLSWFTFGQGTKVEIKRTVAAPSVFIFPPS
DEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTL
SKADYEKHKVYACEVTHQGLSSPVTKSFNRGEA
    Click to Show/Hide
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
PCA062 [Phase 1 (discontinued)]
Identified from the Human Clinical Data
Click To Hide/Show 2 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data progressive disease (PD)
78.70%
Patients Enrolled
Eligible patients are &ge;18 years old with progressive pCAD+ tumors (excluding HNSCC/ESCC), measurable disease per RECIST v1.1, and ECOG &le;2, with mandatory biopsy consent. Exclusions cover CNS metastases, significant comorbidities, prior pCAD-targeting biologics, recent anticancer treatments (4 weeks for chemotherapy/biologics, 2 weeks for surgery), and abnormal lab values (ANC <1.5, Hgb <9, platelets <100, hepatic/renal dysfunction). Vision-related risks also preclude participation.

   Click to Show/Hide
Administration Dosage
Forty-seven patients were treated at 10 different dose levels of PCA062, ranging from 0.4 to 5.0 mg/kg every 2 weeks administered as a 1-hour intravenous infusion.
Related Clinical Trial
NCT Number NCT02375958  Clinical Status PHASE1
Clinical Description
A Phase 1 Multi-center, Open-label Dose Escalation and Expansion Study of PCA062 Administered Intravenously in Adult Patients With p-CAD Positive Tumors
Primary Endpoint
The study evaluates the incidence of dose-limiting toxicities (DLTs) within the first 28 days to determine the safety and tolerability of PCA062, establishing a critical early assessment of potential treatment-related severe adverse effects.
Other Endpoint
Key safety and efficacy measures include incidence/severity of adverse events, pharmacokinetic parameters (Cmax, Tmax), and immunogenicity (anti-PCA062 antibodies) over 84 days. Clinical endpoints such as overall response rate (ORR), duration of response (DOR), progression-free survival (PFS), and disease control rate (DCR) are monitored throughout treatment cycles (14-day intervals) and up to 18 months to assess therapeutic efficacy.

   Click to Show/Hide
Experiment 2 Reporting the Activity Date of This ADC [2]
Efficacy Data Disease Control Rate (DCR)
22.60
33.30
22.20 %
Patients Enrolled
Advanced solid tumors expressing P-cadherin, TNBC, head and neck squamous cell carcinoma (HNSCC), esophageal cancer, cervical cancer, and non-small cell lung cancer (NSCLC).
Administration Dosage
At 10 different dose levels of PCA062, ranging from 0.40 to 5.00 mg/kg every 2 weeks administered as a 1-hour intravenous infusion.
Related Clinical Trial
NCT Number NCT02375958  Clinical Status Phase 1
Clinical Description
A phase 1 multi-center, open-label dose escalation and expansion study of PCA062 administered intravenously in adult patients with p-CAD positive tumors.
Primary Endpoint
The MTD was PCA062 3.60 mg/kg every 2 weeks.No patient achieved a complete response. Only 1 patient with stage IV metastatic HNSCC treated at 0.90 mg/kg achieved a confirmed partial response (PR) as best overall response (BOR). The disease control rate (DCR) for the 31 patients with other tumors was 22.60% (95% CI, 9.60-41.10). In patients with HNSCC (n = 6), DCR was 33.30% (95% CI, 4.30-77.70), and in patients with esophageal cancer (n = 9), DCR was 22.20% (95% CI, 2.80-60.00).

   Click to Show/Hide
References
Ref 1 PCA062 in pCAD-positive Tumors.
Ref 2 A First-in-Human, Phase I, Multicenter, Open-Label, Dose-Escalation Study of PCA062: An Antibody-Drug Conjugate Targeting P-Cadherin, in Patients With Solid Tumors. Mol Cancer Ther. 2022 Apr 1;21(4):625-634.