Antibody Information
General Information of This Antibody (ID: ANI0UCSDQ)
| Antibody Name | CQY684 |
|||||
|---|---|---|---|---|---|---|
| Antibody Type | Monoclonal antibody (mAb) |
|||||
| Antibody Subtype | Humanized IgG1-kappa |
|||||
| Antigen Name | Cadherin-3 (CDH3) |
Antigen Info | ||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Sequence |
QVQLQQSGPGLVKPSQTLSLTCAISGDSVSSQSAAWNWIRQSPSRGLEWLGRIYYRSKWY
NDYALSVKSRITINPDTSKNQFSLQLNSVTPEDTAVYYCARGEGYGREGFAIWGQGTLVT VSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVL QSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSEFDYKDDDDKGAPHH HHHH Click to Show/Hide
|
|||||
| Light Chain Sequence |
DIQMTQSPSSLSASVGDRVTITCRASQTISNTLAWYQQKPGKAPKLLIYAASNLQSGVPS
RFSGSGSGTDFTLTISSLQPEDFATYYCQQYLSWFTFGQGTKVEIKRTVAAPSVFIFPPS DEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTL SKADYEKHKVYACEVTHQGLSSPVTKSFNRGEA Click to Show/Hide
|
|||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
PCA062 [Phase 1 (discontinued)]
Identified from the Human Clinical Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | progressive disease (PD) |
78.70%
|
|||
| Patients Enrolled |
Eligible patients are ≥18 years old with progressive pCAD+ tumors (excluding HNSCC/ESCC), measurable disease per RECIST v1.1, and ECOG ≤2, with mandatory biopsy consent. Exclusions cover CNS metastases, significant comorbidities, prior pCAD-targeting biologics, recent anticancer treatments (4 weeks for chemotherapy/biologics, 2 weeks for surgery), and abnormal lab values (ANC <1.5, Hgb <9, platelets <100, hepatic/renal dysfunction). Vision-related risks also preclude participation.
Click to Show/Hide
|
||||
| Administration Dosage |
Forty-seven patients were treated at 10 different dose levels of PCA062, ranging from 0.4 to 5.0 mg/kg every 2 weeks administered as a 1-hour intravenous infusion.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT02375958 | Clinical Status | PHASE1 | ||
| Clinical Description |
A Phase 1 Multi-center, Open-label Dose Escalation and Expansion Study of PCA062 Administered Intravenously in Adult Patients With p-CAD Positive Tumors
|
||||
| Primary Endpoint |
The study evaluates the incidence of dose-limiting toxicities (DLTs) within the first 28 days to determine the safety and tolerability of PCA062, establishing a critical early assessment of potential treatment-related severe adverse effects.
|
||||
| Other Endpoint |
Key safety and efficacy measures include incidence/severity of adverse events, pharmacokinetic parameters (Cmax, Tmax), and immunogenicity (anti-PCA062 antibodies) over 84 days. Clinical endpoints such as overall response rate (ORR), duration of response (DOR), progression-free survival (PFS), and disease control rate (DCR) are monitored throughout treatment cycles (14-day intervals) and up to 18 months to assess therapeutic efficacy.
Click to Show/Hide
|
||||
| Experiment 2 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Disease Control Rate (DCR) |
22.60
33.30 22.20 % |
|||
| Patients Enrolled |
Advanced solid tumors expressing P-cadherin, TNBC, head and neck squamous cell carcinoma (HNSCC), esophageal cancer, cervical cancer, and non-small cell lung cancer (NSCLC).
|
||||
| Administration Dosage |
At 10 different dose levels of PCA062, ranging from 0.40 to 5.00 mg/kg every 2 weeks administered as a 1-hour intravenous infusion.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT02375958 | Clinical Status | Phase 1 | ||
| Clinical Description |
A phase 1 multi-center, open-label dose escalation and expansion study of PCA062 administered intravenously in adult patients with p-CAD positive tumors.
|
||||
| Primary Endpoint |
The MTD was PCA062 3.60 mg/kg every 2 weeks.No patient achieved a complete response. Only 1 patient with stage IV metastatic HNSCC treated at 0.90 mg/kg achieved a confirmed partial response (PR) as best overall response (BOR). The disease control rate (DCR) for the 31 patients with other tumors was 22.60% (95% CI, 9.60-41.10). In patients with HNSCC (n = 6), DCR was 33.30% (95% CI, 4.30-77.70), and in patients with esophageal cancer (n = 9), DCR was 22.20% (95% CI, 2.80-60.00).
Click to Show/Hide
|
||||
References
