Antigen ID	TAR0NUXWI
Antigen Name	Cadherin-3 (CDH3)
Gene Name	CDH3
Gene ID	1001
Synonym	CDHP; Placental cadherin
Sequence	MGLPRGPLASLLLLQVCWLQCAASEPCRAVFREAEVTLEAGGAEQEPGQALGKVFMGCPG QEPALFSTDNDDFTVRNGETVQERRSLKERNPLKIFPSKRILRRHKRDWVVAPISVPENG KGPFPQRLNQLKSNKDRDTKIFYSITGPGADSPPEGVFAVEKETGWLLLNKPLDREEIAK YELFGHAVSENGASVEDPMNISIIVTDQNDHKPKFTQDTFRGSVLEGVLPGTSVMQVTAT DEDDAIYTYNGVVAYSIHSQEPKDPHDLMFTIHRSTGTISVISSGLDREKVPEYTLTIQA TDMDGDGSTTTAVAVVEILDANDNAPMFDPQKYEAHVPENAVGHEVQRLTVTDLDAPNSP AWRATYLIMGGDDGDHFTITTHPESNQGILTTRKGLDFEAKNQHTLYVEVTNEAPFVLKL PTSTATIVVHVEDVNEAPVFVPPSKVVEVQEGIPTGEPVCVYTAEDPDKENQKISYRILR DPAGWLAMDPDSGQVTAVGTLDREDEQFVRNNIYEVMVLAMDNGSPPTTGTGTLLLTLID VNDHGPVPEPRQITICNQSPVRQVLNITDKDLSPHTSPFQAQLTDDSDIYWTAEVNEEGD TVVLSLKKFLKQDTYDVHLSLSDHGNKEQLTVIRATVCDCHGHVETCPGPWKGGFILPVL GAVLALLFLLLVLLLLVRKKRKIKEPLLLPEDDTRDNVFYYGEEGGGEEDQDYDITQLHR GLEARPEVVLRNDVAPTIIPTPMYRPRPANPDEIGNFIIENLKAANTDPTAPPYDTLLVF DYEGSGSDAASLSSLTSSASDQDQDYDYLNEWGSRFKKLADMYGGGEDD     Click to Show/Hide
Function	Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types.     Click to Show/Hide
Uniprot Entry	CADH3_HUMAN
HGNC ID	HGNC:1762
KEGG ID	hsa:1001

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	PCA-062	Mertansine DM1	Microtubule (MT)	Succinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC)	[1]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	BC3195	Undisclosed	Undisclosed	Undisclosed	[2]
ADC Info	Antibody-drug conjugate (Novartis/ImmunoGen)	Undisclosed	Undisclosed	Undisclosed	[3]

Differential expression pattern of antigen in diseases
The Studied Tissue	Gingival
The Specific Disease	Bacterial infection of gingival
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.98E-06; Fold-change: 0.312974442; Z-score: 0.574868417
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Brainstem
The Specific Disease	Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.22133806; Fold-change: 0.267523279; Z-score: 1.009643288
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	White matter
The Specific Disease	Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.04657237; Fold-change: -0.463013073; Z-score: -1.254622406
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Brainstem
The Specific Disease	Neuroectodermal tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.082472638; Fold-change: -0.502756249; Z-score: -1.67665349
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Nervous
The Specific Disease	Brain cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.48E-06; Fold-change: 0.099519501; Z-score: 0.256379777
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Polycythemia vera
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.200362143; Fold-change: 0.00329512; Z-score: 0.033513731
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Whole blood
The Specific Disease	Myelofibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.111454982; Fold-change: 0.081090145; Z-score: 0.730605987
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Myelodysplastic syndromes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.891036786; Fold-change: -0.038256011; Z-score: -0.123679133
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.796878246; Fold-change: 0.00520268; Z-score: 0.038447685
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Tonsil
The Specific Disease	Lymphoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.94757257; Fold-change: -0.082052584; Z-score: -0.246589579
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Gastric
The Specific Disease	Gastric cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.001771346; Fold-change: 1.866146904; Z-score: 8.557215056
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 6.68E-11; Fold-change: 1.79386971; Z-score: 3.334418001
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Colon
The Specific Disease	Colon cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.01E-175; Fold-change: 3.189547292; Z-score: 6.43247428
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 8.90E-112; Fold-change: 2.88008418; Z-score: 5.212000052
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Pancreas
The Specific Disease	Pancreatic cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.31E-14; Fold-change: 1.765968213; Z-score: 3.843922719
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 7.12E-28; Fold-change: 1.745049882; Z-score: 2.335066041
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Liver
The Specific Disease	Liver cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.325721621; Fold-change: -0.122745365; Z-score: -0.390453219
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.002523788; Fold-change: -0.111449516; Z-score: -0.393304823
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 0.085992999; Fold-change: 0.126750644; Z-score: 0.363775071
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual Download Antigen expression data in the tissue of the other disease section

Differential expression pattern of antigen in diseases
The Studied Tissue	Lung
The Specific Disease	Lung cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.64E-113; Fold-change: 2.294540517; Z-score: 3.230510938
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 3.51E-71; Fold-change: 2.36202257; Z-score: 3.244639727
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Melanoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.507008516; Fold-change: 0.109314572; Z-score: 0.070928944
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Muscle
The Specific Disease	Sarcoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.36E-41; Fold-change: 0.408811163; Z-score: 0.996070339
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.00366871; Fold-change: 0.086372704; Z-score: 0.559451785
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Breast
The Specific Disease	Breast cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.48E-12; Fold-change: -0.898776885; Z-score: -0.755531149
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.221529179; Fold-change: -0.41621369; Z-score: -0.362838956
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Ovarian
The Specific Disease	Ovarian cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.009629811; Fold-change: -0.614351847; Z-score: -1.080989267
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.283902519; Fold-change: 0.18286661; Z-score: 0.13455202
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Cervical
The Specific Disease	Cervical cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.016905721; Fold-change: 0.859965568; Z-score: 1.026441844
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Endometrium
The Specific Disease	Uterine cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.52E-27; Fold-change: 2.167896224; Z-score: 1.552260982
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.01E-14; Fold-change: 4.037963608; Z-score: 21.99147751
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Prostate
The Specific Disease	Prostate cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.014105349; Fold-change: -0.324986772; Z-score: -0.366887225
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bladder
The Specific Disease	Bladder cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.91E-06; Fold-change: 1.324569237; Z-score: 3.03839386
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Uvea
The Specific Disease	Retinoblastoma tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.109923649; Fold-change: 0.3998877; Z-score: 2.662785524
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Thyroid
The Specific Disease	Thyroid cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.27E-70; Fold-change: 3.082152394; Z-score: 4.667465223
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 2.60E-26; Fold-change: 3.003118171; Z-score: 3.547756013
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Adrenal cortex
The Specific Disease	Adrenocortical carcinoma
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 0.246442136; Fold-change: -0.00133767; Z-score: -0.008790478
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of the other disease section

Differential expression pattern of antigen in diseases
The Studied Tissue	Head and neck
The Specific Disease	Head and neck cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.89E-44; Fold-change: 2.432595724; Z-score: 2.734355238
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Pituitary
The Specific Disease	Pituitary gonadotrope tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.040266479; Fold-change: 0.978140374; Z-score: 1.791150742
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Pituitary
The Specific Disease	Pituitary cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.717318655; Fold-change: 0.672274374; Z-score: 0.963344877
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Thrombocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.414608096; Fold-change: -0.237567765; Z-score: -1.212266767
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Lupus erythematosus
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.926872815; Fold-change: -0.083178903; Z-score: -0.156848904
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral monocyte
The Specific Disease	Autoimmune uveitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.757602377; Fold-change: -0.075375022; Z-score: -0.427679955
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Familial hypercholesterolemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.72E-06; Fold-change: -0.402003923; Z-score: -1.397058873
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Superior temporal cortex
The Specific Disease	Schizophrenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.223323871; Fold-change: -0.054926973; Z-score: -0.446486128
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Spinal cord
The Specific Disease	Multiple sclerosis
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.104666215; Fold-change: 0.238886293; Z-score: 1.356843838
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue
The Studied Tissue	Plasmacytoid dendritic cells
The Specific Disease	Multiple sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.371303767; Fold-change: -0.100295713; Z-score: -0.354706454
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peritumoral cortex
The Specific Disease	Epilepsy
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 0.317125635; Fold-change: 0.298507403; Z-score: 0.988930637
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of the other disease section

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Cardioembolic Stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.880273095; Fold-change: 0.007548469; Z-score: 0.032196352
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Peripheral blood
The Specific Disease	Ischemic stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.138442003; Fold-change: 0.126231214; Z-score: 0.604900143
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	White matter
The Specific Disease	HIV
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.904599794; Fold-change: 0.00416331; Z-score: 0.023555652
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Influenza
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.006639662; Fold-change: 0.436690991; Z-score: 2.929443491
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Chronic hepatitis C
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.598093692; Fold-change: -0.003367031; Z-score: -0.017083583
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Sepsis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.125029743; Fold-change: -0.065700052; Z-score: -0.247711497
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Septic shock
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.586334263; Fold-change: -0.044369904; Z-score: -0.139912445
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Pediatric respiratory syncytial virus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.290189271; Fold-change: -0.052629914; Z-score: -0.356735208
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Essential hypertension
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.673373951; Fold-change: -0.025869194; Z-score: -0.079325384
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Myocardial infarction
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.725464764; Fold-change: -0.004428189; Z-score: -0.008938673
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Coronary artery disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.126357204; Fold-change: -0.20036978; Z-score: -1.210183836
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Calcified aortic valve
The Specific Disease	Aortic stenosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.747320246; Fold-change: -0.074968989; Z-score: -0.122510366
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Arteriosclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.288435955; Fold-change: -0.107017327; Z-score: -0.585498249
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Intracranial artery
The Specific Disease	Aneurysm
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.58E-05; Fold-change: 1.147984584; Z-score: 3.499911765
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Immunodeficiency
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.218197039; Fold-change: 0.079072069; Z-score: 0.710202366
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Hyperplastic tonsil
The Specific Disease	Apnea
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.132373276; Fold-change: -0.456503179; Z-score: -0.595671262
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Olive pollen allergy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.055433204; Fold-change: 0.158775726; Z-score: 1.819418523
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Sinus mucosa
The Specific Disease	Chronic rhinosinusitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.163731911; Fold-change: 0.567433567; Z-score: 0.926699458
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Lung
The Specific Disease	Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.487263596; Fold-change: 0.281822865; Z-score: 0.360612581
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Small airway epithelium
The Specific Disease	Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.28E-06; Fold-change: -0.357734714; Z-score: -0.465438226
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Nasal and bronchial airway
The Specific Disease	Asthma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.21E-05; Fold-change: 0.286810794; Z-score: 0.422119949
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Nasal Epithelium
The Specific Disease	Human rhinovirus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.096184114; Fold-change: 0.143000851; Z-score: 0.356450873
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Lung
The Specific Disease	Idiopathic pulmonary fibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.73E-09; Fold-change: 2.098471976; Z-score: 8.779817427
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Gingival
The Specific Disease	Periodontal disease
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.76E-05; Fold-change: 0.334710018; Z-score: 0.609261527
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Gastric antrum
The Specific Disease	Eosinophilic gastritis
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.108836301; Fold-change: 0.522264897; Z-score: 2.636678033
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Liver
The Specific Disease	Liver failure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.149281694; Fold-change: 0.115773291; Z-score: 0.397700249
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Colon mucosal
The Specific Disease	Ulcerative colitis
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 6.69E-07; Fold-change: 0.760189324; Z-score: 2.038172782
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Rectal colon
The Specific Disease	Irritable bowel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.183717752; Fold-change: 0.199010876; Z-score: 0.382125541
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Atopic dermatitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.88E-08; Fold-change: 0.832866533; Z-score: 3.240129785
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Psoriasis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.88E-33; Fold-change: 1.290426792; Z-score: 2.488617013
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 2.18E-09; Fold-change: 0.684134498; Z-score: 1.435115051
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Vitiligo
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.001045779; Fold-change: -0.482458281; Z-score: -1.623449281
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin from scalp
The Specific Disease	Alopecia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.158782201; Fold-change: -0.035788645; Z-score: -0.187838952
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Sensitive skin
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.263981632; Fold-change: 0.042306213; Z-score: 0.703716097
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Synovial
The Specific Disease	Osteoarthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.886180671; Fold-change: -0.006593945; Z-score: -0.017211022
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Arthropathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.575968577; Fold-change: 0.01375408; Z-score: 0.08106389
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.048419909; Fold-change: -0.112616646; Z-score: -0.446281889
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Synovial
The Specific Disease	Rheumatoid arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.001533638; Fold-change: -0.448771378; Z-score: -2.207156454
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Pheripheral blood
The Specific Disease	Ankylosing spondylitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.017660709; Fold-change: -0.210560716; Z-score: -1.136207102
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Osteoporosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.00964788; Fold-change: 0.277029682; Z-score: 2.343833825
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Endometrium
The Specific Disease	Endometriosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000119235; Fold-change: 1.078603938; Z-score: 1.344481391
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bladder
The Specific Disease	Interstitial cystitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.974426678; Fold-change: 0.255685518; Z-score: 0.872565825
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Myometrium
The Specific Disease	Preterm birth
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.132825049; Fold-change: -0.386888684; Z-score: -0.954489923
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Acute myelocytic leukemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.153751362; Fold-change: 0.049248643; Z-score: 0.203027276
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000449532; Fold-change: -0.784732381; Z-score: -2.259210055
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Peripheral blood
The Specific Disease	Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.371305694; Fold-change: 0.026128218; Z-score: 0.16369685
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Oral
The Specific Disease	Oral cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.20E-07; Fold-change: 2.246779102; Z-score: 1.628447211
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 4.98E-23; Fold-change: 1.478880262; Z-score: 1.544980774
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Esophagus
The Specific Disease	Esophagal cancer
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.017309668; Fold-change: 1.142844041; Z-score: 1.509473143
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Rectal colon
The Specific Disease	Rectal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.64E-05; Fold-change: 3.048725043; Z-score: 5.482787481
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.83E-06; Fold-change: 2.75522914; Z-score: 6.48742657
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Skin cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000687525; Fold-change: 0.639623304; Z-score: 1.048143367
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.621645992; Fold-change: 0.348539894; Z-score: 0.638643892
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Kidney
The Specific Disease	Renal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.023994267; Fold-change: -0.778624372; Z-score: -0.887120546
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.06E-15; Fold-change: -1.108003253; Z-score: -1.699828335
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Urothelium
The Specific Disease	Ureter cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.57770137; Fold-change: 0.071584293; Z-score: 0.323806514
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Adipose
The Specific Disease	Simpson golabi behmel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.077024179; Fold-change: -0.109765433; Z-score: -2.257348988
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Perituberal
The Specific Disease	Tuberous sclerosis complex
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.044156037; Fold-change: 0.232636368; Z-score: 1.404739189
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Anemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.06776945; Fold-change: 0.531350621; Z-score: 1.368203668
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Sickle cell disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.927284873; Fold-change: 0.005547319; Z-score: 0.034101116
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Thrombocythemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.126567634; Fold-change: 0.106898173; Z-score: 0.956817584
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Scleroderma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.001703542; Fold-change: 0.610657312; Z-score: 1.989699255
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Salivary gland
The Specific Disease	Sjogren syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000116271; Fold-change: 0.852736343; Z-score: 5.686484475
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.000276594; Fold-change: -0.959671597; Z-score: -3.893864188
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Behcet disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.618917439; Fold-change: 0.046784855; Z-score: 0.289659378
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Autosomal dominant monocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.295188227; Fold-change: 0.041571136; Z-score: 0.29162909
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Liver
The Specific Disease	Type 2 diabetes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.502861582; Fold-change: -0.11193318; Z-score: -0.246838855
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Vastus lateralis muscle
The Specific Disease	Polycystic ovary syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.132012332; Fold-change: 0.003019177; Z-score: 0.016436748
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Subcutaneous Adipose
The Specific Disease	Obesity
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.186442874; Fold-change: 0.075308082; Z-score: 0.560290511
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Biceps muscle
The Specific Disease	Pompe disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.616766616; Fold-change: -0.013582546; Z-score: -0.059863094
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Batten disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.48736619; Fold-change: 0.01554352; Z-score: 0.076066062
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Autism
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Anxiety disorder
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.675865045; Fold-change: -0.02308005; Z-score: -0.077556662
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Substantia nigra
The Specific Disease	Parkinson disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.159831687; Fold-change: -0.035920785; Z-score: -0.149800167
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Huntington disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.20824713; Fold-change: 0.08588911; Z-score: 0.484210334
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Entorhinal cortex
The Specific Disease	Alzheimer disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.0118919; Fold-change: -0.117705335; Z-score: -0.453478976
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Seizure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.392686016; Fold-change: -0.024878641; Z-score: -0.171611885
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.477255654; Fold-change: -0.174712881; Z-score: -0.814791733
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Cervical spinal cord
The Specific Disease	Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.681129501; Fold-change: -0.239272877; Z-score: -0.532236386
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Muscle
The Specific Disease	Muscular atrophy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.565592486; Fold-change: 0.003679071; Z-score: 0.015383445
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Muscle
The Specific Disease	Myopathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.806695905; Fold-change: -0.020551279; Z-score: -0.057969595
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Ref 1	PCA062, a P-cadherin Targeting Antibody-Drug Conjugate, Displays Potent Antitumor Activity Against P-cadherin-expressing Malignancies. Mol Cancer Ther. 2021 Jul;20(7):1270-1282. doi: 10.1158/1535-7163.MCT-20-0708. Epub 2021 Apr 20.
Ref 2	BC3195: world's first next-generation antibody-coupled drug (ADC) targeting CDH3 approved for US clinical trials.
Ref 3	Introduction to basic information on antibody-drug conjugate(Novartis/ImmunoGen).