Antibody Information
General Information of This Antibody
| Antibody ID | ANI0THIPX |
|||||
|---|---|---|---|---|---|---|
| Antibody Name | SHR-A1403 mAb |
|||||
| Antibody Type | Monoclonal antibody (mAb) |
|||||
| Antibody Subtype | Humanized IgG2-kappa |
|||||
| Antigen Name | Hepatocyte growth factor receptor (MET) |
Antigen Info | ||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Sequence |
QVQLVESGGGVVQPGRSLRLSCAASGFSLSNYGVHWVRQAPGKGLEWLAVIWSGGSTNYA
AAFVSRLTISKDNSKNTVYLQMNSLRAEDTAVYYCARNHDNPYNYAMDYWGQGTTVTVSS ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS GLYSLSSVVTVPSSNFGTQTYTCNVDHKPSNTKVDKTVERKCCVECPPCPAPPVAGPSVF LFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFR VVSVLTVVHQDWLNGKEYKCKVSNKGLPAPIEKTISKTKGQPREPQVYTLPPSREEMTKN QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSRWQQGN VFSCSVMHEALHNHYTQKSLSLSPGK Click to Show/Hide
|
|||||
| Light Chain Sequence |
DIVLTQSPDSLAVSLGERATINCRADKSVSTSTYNYLHWYQQKPGQPPKLLIYLASNLAS
GVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQHSRDLPPTFGQGTKLEIKRTVAAPSVF IFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLS STLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Click to Show/Hide
|
|||||
The Activity Data of This Antibody
| Antibody Activity Information 1 | [1] | |||||
|
Dissociation Constant (Kd)
|
15.8
|
nM
|
||||
|---|---|---|---|---|---|---|
| Antibody Function | Confirm the effect of the drug conjugation with the anti c-Met mAb and ADC on binding activity to target. | |||||
| Antibody Antigen Binding Assay | The binding affinity of SHR-A1403 to c-Met protein derived from human, cynomolgus monkey, and mouse was evaluated by the KD determined using Biacore assays and compared to that of naked SHR-A1403 mAb. | |||||
| Antibody Activity Information 2 | [1] | |||||
|
Dissociation Constant (Kd)
|
28.4
|
nM
|
||||
| Antibody Function | Confirm the effect of the drug conjugation with the anti c-Met mAb and ADC on binding activity to target. | |||||
| Antibody Antigen Binding Assay | The binding affinity of SHR-A1403 to c-Met protein derived from human, cynomolgus monkey, and mouse was evaluated by the KD determined using Biacore assays and compared to that of naked SHR-A1403 mAb. | |||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
SHR-A1403 [Phase 1]
Identified from the Human Clinical Data
| Experiment 1 Reporting the Activity Date of This ADC | [2] | ||||
| Related Clinical Trial | |||||
| NCT Number | NCT03856541 | Clinical Status | Phase 1 | ||
| Clinical Description |
A phase 1, open label, dose escalation study to evaluate the safety, tolerability and pharmacokinetics of SHR-a1403 with intravenous infusion in patients with advanced solid tumors.
|
||||
Discovered Using Patient-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 95.50% (Day 17) | High MET expression (MET+++) | ||
| Method Description |
HCC tumor cells derived from patients (passage 5) were implanted subcutaneously in BALB/c nude mice at an initial tumor size of approximately 30 mm3. In this model,tumor-bearing mice were given vehicle,SHR-A1403 (1 mg/kg),or SHR-A1403 mAb (10 mg/kg) via twice-weekly intravenous injection for two consecutive weeks.
|
||||
| In Vivo Model | Hepatic cancer PDX model (PDX: HCC) | ||||
| Experiment 2 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 98.30% (Day 17) | High MET expression (MET+++) | ||
| Method Description |
HCC tumor cells derived from patients (passage 5) were implanted subcutaneously in BALB/c nude mice at an initial tumor size of approximately 30 mm3. In this model,tumor-bearing mice were given vehicle,SHR-A1403 (3 mg/kg),or SHR-A1403 mAb (10 mg/kg) via twice-weekly intravenous injection for two consecutive weeks.
|
||||
| In Vivo Model | Hepatic cancer PDX model (PDX: HCC) | ||||
| Experiment 3 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 98.50% (Day 17) | High MET expression (MET+++) | ||
| Method Description |
HCC tumor cells derived from patients (passage 5) were implanted subcutaneously in BALB/c nude mice at an initial tumor size of approximately 30 mm3. In this model,tumor-bearing mice were given vehicle,SHR-A1403 (10 mg/kg),or SHR-A1403 mAb (10 mg/kg) via twice-weekly intravenous injection for two consecutive weeks.
|
||||
| In Vivo Model | Hepatic cancer PDX model (PDX: HCC) | ||||
Discovered Using Cell Line-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [4] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 0.00% (Day 16) | Negative MET expression (MET-) | ||
| Method Description |
Effects of SHR-A1403 were further determined in vivo by assessing the growth of HCC827 and HA1 xenograft tumors. Tumor-bearing mice,established by s.c. inoculation of HCC827 and HA1 cells,were randomized into vehicle,AZD9291 (3 mg/kg single dose,i.g.) and SHR-A1403 (10 mg/kg single dose,i.v.) treatment groups when average tumor volumes reached approximately 100-200 mm3.
Click to Show/Hide
|
||||
| In Vivo Model | Non-small cell lung cancer HCC827 CDX model (CDX: HA1; Afatinib resistant) | ||||
| In Vitro Model | Lung adenocarcinoma | HCC827 cells (Afatinib resistant; HA1) | CVCL_2063 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 34.50% (Day 21) | High MET expression (MET+++) | ||
| Method Description |
SHR-A1403 was evaluated in xenograft mice bearing cancer cells with high c-Met expression,including hepatic cancer HCCLM3,lung cancer NCI-H1993,and gastric cancer MKN-45 cells,and the effects were compared with the effects of SHR-A1403 mAb,the free toxin,or their combination. In the HCCLM3 xenograft model,SHR-A1403 was administered at a single dose of 1 mg/kg.
Click to Show/Hide
|
||||
| In Vivo Model | Hepatic cancer CDX model | ||||
| In Vitro Model | Adult hepatocellular carcinoma | HCCLM3 cells | CVCL_6832 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 41.80% (Day 21) | High MET expression (MET+++) | ||
| Method Description |
SHR-A1403 was evaluated in xenograft mice bearing cancer cells with high c-Met expression,including hepatic cancer HCCLM3,lung cancer NCI-H1993,and gastric cancer MKN-45 cells,and the effects were compared with the effects of SHR-A1403 mAb,the free toxin,or their combination. In the NCI-H1993 xenograft model,SHR-A1403 was administered at a single dose of 1 mg/kg.
Click to Show/Hide
|
||||
| In Vivo Model | Lung cancer CDX model | ||||
| In Vitro Model | Lung cancer | Lung cancer cells | Homo sapiens | ||
| Experiment 4 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 42.80% (Day 21) | High MET expression (MET+++) | ||
| Method Description |
SHR-A1403 was evaluated in xenograft mice bearing cancer cells with high c-Met expression,including hepatic cancer HCCLM3,lung cancer NCI-H1993,and gastric cancer MKN-45 cells,and the effects were compared with the effects of SHR-A1403 mAb,the free toxin,or their combination. In the MKN-45 xenograft model,SHR-A1403 was administered at a single dose of 1 mg/kg.
Click to Show/Hide
|
||||
| In Vivo Model | Gastric cancer CDX model | ||||
| In Vitro Model | Gastric cancer | Gastric cancer cells | Homo sapiens | ||
| Experiment 5 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 59.30% (Day 21) | High MET expression (MET+++) | ||
| Method Description |
SHR-A1403 was evaluated in xenograft mice bearing cancer cells with high c-Met expression,including hepatic cancer HCCLM3,lung cancer NCI-H1993,and gastric cancer MKN-45 cells,and the effects were compared with the effects of SHR-A1403 mAb,the free toxin,or their combination. In the NCI-H1993 xenograft model,SHR-A1403 was administered at a single dose of 3 mg/kg.
Click to Show/Hide
|
||||
| In Vivo Model | Lung cancer CDX model | ||||
| In Vitro Model | Lung cancer | Lung cancer cells | Homo sapiens | ||
| Experiment 6 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 83.30% (Day 21) | High MET expression (MET+++) | ||
| Method Description |
SHR-A1403 was evaluated in xenograft mice bearing cancer cells with high c-Met expression,including hepatic cancer HCCLM3,lung cancer NCI-H1993,and gastric cancer MKN-45 cells,and the effects were compared with the effects of SHR-A1403 mAb,the free toxin,or their combination. In the HCCLM3 xenograft model,SHR-A1403 was administered at a single dose of 3 mg/kg.
Click to Show/Hide
|
||||
| In Vivo Model | Hepatic cancer CDX model | ||||
| In Vitro Model | Adult hepatocellular carcinoma | HCCLM3 cells | CVCL_6832 | ||
| Experiment 7 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 84.60% (Day 21) | High MET expression (MET+++) | ||
| Method Description |
SHR-A1403 was evaluated in xenograft mice bearing cancer cells with high c-Met expression,including hepatic cancer HCCLM3,lung cancer NCI-H1993,and gastric cancer MKN-45 cells,and the effects were compared with the effects of SHR-A1403 mAb,the free toxin,or their combination. In the MKN-45 xenograft model,SHR-A1403 was administered at a single dose of 3 mg/kg.
Click to Show/Hide
|
||||
| In Vivo Model | Gastric cancer CDX model | ||||
| In Vitro Model | Gastric adenocarcinoma | MKN45 cells | CVCL_0434 | ||
| Experiment 8 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 89.90% (Day 21) | High MET expression (MET+++) | ||
| Method Description |
SHR-A1403 was evaluated in xenograft mice bearing cancer cells with high c-Met expression,including hepatic cancer HCCLM3,lung cancer NCI-H1993,and gastric cancer MKN-45 cells,and the effects were compared with the effects of SHR-A1403 mAb,the free toxin,or their combination. In the MKN-45 xenograft model,SHR-A1403 was administered at a single dose of 10 mg/kg.
Click to Show/Hide
|
||||
| In Vivo Model | Gastric cancer CDX model | ||||
| In Vitro Model | Gastric adenocarcinoma | MKN45 cells | CVCL_0434 | ||
| Experiment 9 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 91.60% (Day 21) | High MET expression (MET+++) | ||
| Method Description |
SHR-A1403 was evaluated in xenograft mice bearing cancer cells with high c-Met expression,including hepatic cancer HCCLM3,lung cancer NCI-H1993,and gastric cancer MKN-45 cells,and the effects were compared with the effects of SHR-A1403 mAb,the free toxin,or their combination. In the NCI-H1993 xenograft model,SHR-A1403 was administered at a single dose of 10 mg/kg.
Click to Show/Hide
|
||||
| In Vivo Model | Lung cancer CDX model | ||||
| In Vitro Model | Lung adenocarcinoma | NCI-H1993 cells | CVCL_1512 | ||
| Experiment 10 Reporting the Activity Date of This ADC | [4] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 92.80% (Day 21) | High MET expression (MET+++) | ||
| Method Description |
Effects of SHR-A1403 were further determined in vivo by assessing the growth of HCC827 and HA1 xenograft tumors. Tumor-bearing mice,established by s.c. inoculation of HCC827 and HA1 cells,were randomized into vehicle,AZD9291 (3 mg/kg single dose,i.g.) and SHR-A1403 (10 mg/kg single dose,i.v.) treatment groups when average tumor volumes reached approximately 100-200 mm3.
Click to Show/Hide
|
||||
| In Vivo Model | Non-small cell lung cancer CDX model | ||||
| In Vitro Model | Lung adenocarcinoma | HCC827 cells | CVCL_2063 | ||
| Experiment 11 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 98.80% (Day 21) | High MET expression (MET+++) | ||
| Method Description |
SHR-A1403 was evaluated in xenograft mice bearing cancer cells with high c-Met expression,including hepatic cancer HCCLM3,lung cancer NCI-H1993,and gastric cancer MKN-45 cells,and the effects were compared with the effects of SHR-A1403 mAb,the free toxin,or their combination. In the HCCLM3 xenograft model,SHR-A1403 was administered at a single dose of 10 mg/kg.
Click to Show/Hide
|
||||
| In Vivo Model | Hepatic cancer CDX model | ||||
| In Vitro Model | Adult hepatocellular carcinoma | HCCLM3 cells | CVCL_6832 | ||
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
3.20 ng/mL
|
High MET expression (MET+++; IHC 3+) | ||
| Method Description |
The effects of SHR-A1403 on the proliferation of various types of human cancer cells were evaluated and compared with the effects of SHR-A1403 mAb and the free toxin SHR152852.
|
||||
| In Vitro Model | Adult hepatocellular carcinoma | HCCLM3 cells | CVCL_6832 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
7.80 ng/mL
|
Negative MET expression (MET-) | ||
| Method Description |
The effects of SHR-A1403 on the proliferation of various types of human cancer cells were evaluated and compared with the effects of SHR-A1403 mAb and the free toxin SHR152852.
|
||||
| In Vitro Model | Gastric adenocarcinoma | MKN45 cells | CVCL_0434 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [4] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
11.80 ng/mL
|
Moderate MET expression (MET++) | ||
| Method Description |
To establish the EGFR inhibitor-resistant NSCLC cells,HCC827 cells were grown initially in medium containing 10 nmol/L gefitinib or afatinib. To exam the ability of the ADC,SHR-A1403,to overcome AZD9291 resistance. Human tumor xenografts were established by s.c. inoculation of nude mice with HCC827,HA1 or HG3 cells. Tumor-bearing mice were randomized into groups and treated with vehicle,AZD9291 intragastric administration (i.g.) or SHR-A1403 intravenous injection (i.v.) when average tumor volume reached approximately 100-200 mm3. Resistance ratio = IC50 (resistant cells)/IC50 (HCC827).
Click to Show/Hide
|
||||
| In Vitro Model | Lung adenocarcinoma | HCC827 cells (Afatinib resistant; HA1) | CVCL_2063 | ||
| Experiment 4 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
16.30 ng/mL
|
High MET expression (MET+++) | ||
| Method Description |
The effects of SHR-A1403 on the proliferation of various types of human cancer cells were evaluated and compared with the effects of SHR-A1403 mAb and the free toxin SHR152852.
|
||||
| In Vitro Model | Lung adenocarcinoma | NCI-H1993 cells | CVCL_1512 | ||
| Experiment 5 Reporting the Activity Date of This ADC | [4] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
17.80 ng/mL
|
High MET expression (MET+++) | ||
| Method Description |
To establish the EGFR inhibitor-resistant NSCLC cells,HCC827 cells were grown initially in medium containing 10 nmol/L gefitinib or afatinib. To exam the ability of the ADC,SHR-A1403,to overcome AZD9291 resistance. Human tumor xenografts were established by s.c. inoculation of nude mice with HCC827,HA1 or HG3 cells. Tumor-bearing mice were randomized into groups and treated with vehicle,AZD9291 intragastric administration (i.g.) or SHR-A1403 intravenous injection (i.v.) when average tumor volume reached approximately 100-200 mm3. Resistance ratio = IC50 (resistant cells)/IC50 (HCC827).
Click to Show/Hide
|
||||
| In Vitro Model | Lung adenocarcinoma | HCC827 cells (Gefitinib resistant) | CVCL_2063 | ||
| Experiment 6 Reporting the Activity Date of This ADC | [4] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
26.60 ng/mL
|
Negative MET expression (MET-) | ||
| Method Description |
To establish the EGFR inhibitor-resistant NSCLC cells,HCC827 cells were grown initially in medium containing 10 nmol/L gefitinib or afatinib. To exam the ability of the ADC,SHR-A1403,to overcome AZD9291 resistance. Human tumor xenografts were established by s.c. inoculation of nude mice with HCC827,HA1 or HG3 cells. Tumor-bearing mice were randomized into groups and treated with vehicle,AZD9291 intragastric administration (i.g.) or SHR-A1403 intravenous injection (i.v.) when average tumor volume reached approximately 100-200 mm3. Resistance ratio = IC50 (resistant cells)/IC50 (HCC827).
Click to Show/Hide
|
||||
| In Vitro Model | Lung adenocarcinoma | HCC827 cells (Gefitinib resistant) | CVCL_2063 | ||
| Experiment 7 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
46.70 ng/mL
|
Moderate MET expression (MET++) | ||
| Method Description |
The effects of SHR-A1403 on the proliferation of various types of human cancer cells were evaluated and compared with the effects of SHR-A1403 mAb and the free toxin SHR152852.
|
||||
| In Vitro Model | Lung papillary adenocarcinoma | NCI-H441 cells | CVCL_1561 | ||
| Experiment 8 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
53.90 ng/mL
|
High MET expression (MET+++; IHC 3+) | ||
| Method Description |
The effects of SHR-A1403 on the proliferation of various types of human cancer cells were evaluated and compared with the effects of SHR-A1403 mAb and the free toxin SHR152852.
|
||||
| In Vitro Model | Invasive breast carcinoma | Hs 578T cells | CVCL_0332 | ||
| Experiment 9 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
78.20 ng/mL
|
High MET expression (MET+++) | ||
| Method Description |
The effects of SHR-A1403 on the proliferation of various types of human cancer cells were evaluated and compared with the effects of SHR-A1403 mAb and the free toxin SHR152852.
|
||||
| In Vitro Model | Prostate carcinoma | PC-3 cells | CVCL_0035 | ||
| Experiment 10 Reporting the Activity Date of This ADC | [4] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
99.40 ng/mL
|
Moderate MET expression (MET++) | ||
| Method Description |
To establish the EGFR inhibitor-resistant NSCLC cells,HCC827 cells were grown initially in medium containing 10 nmol/L gefitinib or afatinib. To exam the ability of the ADC,SHR-A1403,to overcome AZD9291 resistance. Human tumor xenografts were established by s.c. inoculation of nude mice with HCC827,HA1 or HG3 cells. Tumor-bearing mice were randomized into groups and treated with vehicle,AZD9291 intragastric administration (i.g.) or SHR-A1403 intravenous injection (i.v.) when average tumor volume reached approximately 100-200 mm3. Resistance ratio = IC50 (resistant cells)/IC50 (HCC827).
Click to Show/Hide
|
||||
| In Vitro Model | Lung adenocarcinoma | HCC827 cells (Gefitinib resistant) | CVCL_2063 | ||
| Experiment 11 Reporting the Activity Date of This ADC | [4] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
130.80 ng/mL
|
High MET expression (MET+++) | ||
| Method Description |
To establish the EGFR inhibitor-resistant NSCLC cells,HCC827 cells were grown initially in medium containing 10 nmol/L gefitinib or afatinib. To exam the ability of the ADC,SHR-A1403,to overcome AZD9291 resistance. Human tumor xenografts were established by s.c. inoculation of nude mice with HCC827,HA1 or HG3 cells. Tumor-bearing mice were randomized into groups and treated with vehicle,AZD9291 intragastric administration (i.g.) or SHR-A1403 intravenous injection (i.v.) when average tumor volume reached approximately 100-200 mm3. Resistance ratio = IC50 (resistant cells)/IC50 (HCC827).
Click to Show/Hide
|
||||
| In Vitro Model | Lung adenocarcinoma | HCC827 cells (Gefitinib resistant) | CVCL_2063 | ||
| Experiment 12 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
214.80 ng/mL
|
Moderate MET expression (MET++) | ||
| Method Description |
The effects of SHR-A1403 on the proliferation of various types of human cancer cells were evaluated and compared with the effects of SHR-A1403 mAb and the free toxin SHR152852.
|
||||
| In Vitro Model | Clear cell renal cell carcinoma | Caki-1 cells | CVCL_0234 | ||
| Experiment 13 Reporting the Activity Date of This ADC | [4] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
918.90 ng/mL
|
Moderate MET expression (MET++) | ||
| Method Description |
To establish the EGFR inhibitor-resistant NSCLC cells,HCC827 cells were grown initially in medium containing 10 nmol/L gefitinib or afatinib. To exam the ability of the ADC,SHR-A1403,to overcome AZD9291 resistance. Human tumor xenografts were established by s.c. inoculation of nude mice with HCC827,HA1 or HG3 cells. Tumor-bearing mice were randomized into groups and treated with vehicle,AZD9291 intragastric administration (i.g.) or SHR-A1403 intravenous injection (i.v.) when average tumor volume reached approximately 100-200 mm3. Resistance ratio = IC50 (resistant cells)/IC50 (HCC827).
Click to Show/Hide
|
||||
| In Vitro Model | Lung adenocarcinoma | HCC827 cells | CVCL_2063 | ||
| Experiment 14 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
1987.50 ng/mL
|
High MET expression (MET+++; IHC 3+) | ||
| Method Description |
The effects of SHR-A1403 on the proliferation of various types of human cancer cells were evaluated and compared with the effects of SHR-A1403 mAb and the free toxin SHR152852.
|
||||
| In Vitro Model | Lung adenocarcinoma | A-549 cells | CVCL_0023 | ||
| Experiment 15 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 10.00 ug/mL | High MET expression (MET+++) | ||
| Method Description |
The effects of SHR-A1403 on the proliferation of various types of human cancer cells were evaluated and compared with the effects of SHR-A1403 mAb and the free toxin SHR152852.
|
||||
| In Vitro Model | Gastric tubular adenocarcinoma | NCI-N87 cells | CVCL_1603 | ||
| Experiment 16 Reporting the Activity Date of This ADC | [4] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 30.00 ug/mL | Negative MET expression (MET-) | ||
| Method Description |
To establish the EGFR inhibitor-resistant NSCLC cells,HCC827 cells were grown initially in medium containing 10 nmol/L gefitinib or afatinib. To exam the ability of the ADC,SHR-A1403,to overcome AZD9291 resistance. Human tumor xenografts were established by s.c. inoculation of nude mice with HCC827,HA1 or HG3 cells. Tumor-bearing mice were randomized into groups and treated with vehicle,AZD9291 intragastric administration (i.g.) or SHR-A1403 intravenous injection (i.v.) when average tumor volume reached approximately 100-200 mm3. Resistance ratio = IC50 (resistant cells)/IC50 (HCC827).
Click to Show/Hide
|
||||
| In Vitro Model | Lung adenocarcinoma | HCC827 cells (Afatinib resistant; HA2) | CVCL_2063 | ||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Shen et al.