Antibody Information
General Information of This Antibody
| Antibody ID | ANI0SBEAR |
|||||
|---|---|---|---|---|---|---|
| Antibody Name | Anti-FGFR2/4 mAb 12422 |
|||||
| Antibody Type | Monoclonal antibody (mAb) |
|||||
| Antibody Subtype | Humanized IgG1-kappa |
|||||
| Antigen Name | Fibroblast growth factor receptor 2 (FGFR2); Fibroblast growth factor receptor 4 (FGFR4) |
Antigen Info | ||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Sequence |
QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGYISPYMGETHY
AQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCARESYEYFDIWGQGTLVTVSSAST KGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLY SLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSV FLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTY RVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTK NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG NVFSCSVMHEALHNHYTQKSLSLSPGK Click to Show/Hide
|
|||||
| Light Chain Sequence |
DIQMTQSPSSLSASVGDRVTITCRASQSISNDLAWYQQKPGKAPKLLIYATSILQSGVPS
RFSGSGSGTDFTLTISSLQPEDFATYYCLQYYDYSYTFGQGTKVEIKRTVAAPSVFIFPP SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Click to Show/Hide
|
|||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
Anti-FGFR2/4 mAb-12422 SMCC-DM1 [Investigative]
Discovered Using Cell Line-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 30.85% | Positive FGFR2 expression (FGFR2+++/++) | ||
| Method Description |
The total injection volume containing cells in suspension was 200 ul. Mice were enrolled in the first study eight days post implantation with average tumor volume of 171.7 mm3. After being randomly assigned to one of nine groups (n =8/group), mice were administered PBS or a single 5 mg/kg intravenous (i.v,) injection of one antibody drug conjugates.
Click to Show/Hide
|
||||
| In Vivo Model | NCI-H716 CDX model | ||||
| In Vitro Model | Cecum adenocarcinoma | NCI-H716 cells | CVCL_1581 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 35.79% | Positive FGFR2 expression (FGFR2+++/++) | ||
| Method Description |
The total injection volume containing cells in suspension was 200 ul. Mice were enrolled in the first study eight days post implantation with average tumor volume of 171.7 mm3. After being randomly assigned to one of nine groups (n =8/group), mice were administered PBS or a single 15 mg/kg intravenous (i.v,) injection of one antibody drug conjugates.
Click to Show/Hide
|
||||
| In Vivo Model | NCI-H716 CDX model | ||||
| In Vitro Model | Cecum adenocarcinoma | NCI-H716 cells | CVCL_1581 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 80.52% | Positive FGFR2 expression (FGFR2+++/++) | ||
| Method Description |
The total injection volume containing cells in suspension was 200 ul. Mice were enrolled in the first study eight days post implantation with average tumor volume of 192.9 mm3. After being randomly assigned to one of nine groups (n =8/group), mice were administered PBS or a single 3 mg/kg intravenous (i.v,) injection of one antibody drug conjugates.
Click to Show/Hide
|
||||
| In Vivo Model | SNU-16 CDX model | ||||
| In Vitro Model | Gastric adenocarcinoma | SNU-16 cells | CVCL_0076 | ||
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | < 3 nM | Positive FGFR2 expression (FGFR2+++/++) | ||
| Method Description |
Cells were counted and seeded in 96 well plates at densities of 2600-3600 cells/well in 100 ul of cell culture medium, A duplicate plate was generated for a day 0 measurement and all plates were incubated in a tissue culture incubator at 37°C with 5% CO2 overnight. Following this incubation, 50 ul/well of Cell titer Glo reagent was added to the day 0 plates, which were then shaken gently for 10 min and the resulting luminescence intensity was measured.
Click to Show/Hide
|
||||
| In Vitro Model | Down syndrome | KATO III cells | CVCL_0371 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | < 3 nM | Positive FGFR2 expression (FGFR2+++/++) | ||
| Method Description |
Cells were counted and seeded in 96 well plates at densities of 2600-3600 cells/well in 100 ul of cell culture medium, A duplicate plate was generated for a day 0 measurement and all plates were incubated in a tissue culture incubator at 37°C with 5% CO2 overnight. Following this incubation, 50 ul/well of Cell titer Glo reagent was added to the day 0 plates, which were then shaken gently for 10 min and the resulting luminescence intensity was measured.
Click to Show/Hide
|
||||
| In Vitro Model | Gastric adenocarcinoma | SNU-16 cells | CVCL_0076 | ||
Anti-FGFR2/4 mAb-12422 SPDB-DM4 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.07 nM
|
Positive FGFR2 expression (FGFR2+++/++) | ||
| Method Description |
Cells were counted and seeded in 96 well plates at densities of 2600-3600 cells/well in 100 ul of cell culture medium, A duplicate plate was generated for a day 0 measurement and all plates were incubated in a tissue culture incubator at 37°C with 5% CO2 overnight. Following this incubation, 50 ul/well of Cell titer Glo reagent was added to the day 0 plates, which were then shaken gently for 10 min and the resulting luminescence intensity was measured.
Click to Show/Hide
|
||||
| In Vitro Model | Gastric adenocarcinoma | SNU-16 cells | CVCL_0076 | ||
