General Information of This Antibody (ID: ANI0SAMUD)
Antibody Name
chmAb-A
Antibody Type
Monoclonal antibody (mAb)
Antibody Subtype
Chimeric IgG1-kappa
Antigen Name
CD276 antigen (CD276)
 Antigen Info 
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence
DVQLVESGGGLVQPGGSRKLSCAASGFTFSSFGMHWVRQAPEKGLEWVAYISSDSSATYY
ADTVKGRFTISRDNPKNTLFLQMTSLRSEDTAMYYCGRGRENIYYGSRLDYWGQGTTITV
SS
    Click to Show/Hide
Light Chain Sequence
DIQMEQTESSLSASIGDRVTISCRASQDISNYLNWYQQKPDGTVKLLIYTSRLHSGVPSR
ESGSGSGTDYSLTIDNLEQEDIATYFCQQGNILPPTEGGGTKLEIK
    Click to Show/Hide
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
ChmAb-A B7-H3-ADC [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 10 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
0.61 nM
High CD276 expression (CD276 +++)
Method Description
Briefly, B7-H3-ADCs and controls are diluted and plated intomicrotiter plates, 5000 cells are added to each well and incubated at 37°C for 4-7 daysAlamar Blue Reagent is added to the plates andread according to the manufacturer's protocol. The number of antibody binding sites presenton these cells was determined using a Bangs QFACSTM Kit.
In Vitro Model Neoplasm Hs 700T cells CVCL_0858
Experiment 2 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
0.7 nM
Moderate CD276 expression (CD276 ++)
Method Description
Briefly, B7-H3-ADCs and controls are diluted and plated intomicrotiter plates, 5000 cells are added to each well and incubated at 37°C for 4-7 daysAlamar Blue Reagent is added to the plates andread according to the manufacturer's protocol. The number of antibody binding sites presenton these cells was determined using a Bangs QFACSTM Kit.
In Vitro Model Amelanotic melanoma A375.S2 cells CVCL_0136
Experiment 3 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
1 nM
Moderate CD276 expression (CD276 ++)
Method Description
Briefly, B7-H3-ADCs and controls are diluted and plated intomicrotiter plates, 5000 cells are added to each well and incubated at 37°C for 4-7 daysAlamar Blue Reagent is added to the plates andread according to the manufacturer's protocol. The number of antibody binding sites presenton these cells was determined using a Bangs QFACSTM Kit.
In Vitro Model Lung adenocarcinoma Calu-6 cells CVCL_0236
Experiment 4 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
1.52 nM
Moderate CD276 expression (CD276 ++)
Method Description
Briefly, B7-H3-ADCs and controls are diluted and plated intomicrotiter plates, 5000 cells are added to each well and incubated at 37°C for 4-7 daysAlamar Blue Reagent is added to the plates andread according to the manufacturer's protocol. The number of antibody binding sites presenton these cells was determined using a Bangs QFACSTM Kit.
In Vitro Model Lung squamous cell carcinoma NCI-H1703 cells CVCL_1490
Experiment 5 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
8.1 nM
Moderate CD276 expression (CD276 ++)
Method Description
Briefly, B7-H3-ADCs and controls are diluted and plated intomicrotiter plates, 5000 cells are added to each well and incubated at 37°C for 4-7 daysAlamar Blue Reagent is added to the plates andread according to the manufacturer's protocol. The number of antibody binding sites presenton these cells was determined using a Bangs QFACSTM Kit.
In Vitro Model Breast adenocarcinoma MDA-MB-468 cells CVCL_0419
Experiment 6 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
8.33 nM
Moderate CD276 expression (CD276 ++)
Method Description
Briefly, B7-H3-ADCs and controls are diluted and plated intomicrotiter plates, 5000 cells are added to each well and incubated at 37°C for 4-7 daysAlamar Blue Reagent is added to the plates andread according to the manufacturer's protocol. The number of antibody binding sites presenton these cells was determined using a Bangs QFACSTM Kit.
In Vitro Model Ovarian mixed germ cell tumor PA-1 cells CVCL_0479
Experiment 7 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
9.1 nM
High CD276 expression (CD276 +++)
Method Description
Briefly, B7-H3-ADCs and controls are diluted and plated intomicrotiter plates, 5000 cells are added to each well and incubated at 37°C for 4-7 daysAlamar Blue Reagent is added to the plates andread according to the manufacturer's protocol. The number of antibody binding sites presenton these cells was determined using a Bangs QFACSTM Kit.
In Vitro Model Breast ductal carcinoma JIMT-1 cells CVCL_2077
Experiment 8 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
20.15 nM
Low CD276 expression (CD276 +)
Method Description
Briefly, B7-H3-ADCs and controls are diluted and plated intomicrotiter plates, 5000 cells are added to each well and incubated at 37°C for 4-7 daysAlamar Blue Reagent is added to the plates andread according to the manufacturer's protocol. The number of antibody binding sites presenton these cells was determined using a Bangs QFACSTM Kit.
In Vitro Model Prostate carcinoma DU145 cells CVCL_0105
Experiment 9 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
26.98 nM
Moderate CD276 expression (CD276 ++)
Method Description
Briefly, B7-H3-ADCs and controls are diluted and plated intomicrotiter plates, 5000 cells are added to each well and incubated at 37°C for 4-7 daysAlamar Blue Reagent is added to the plates andread according to the manufacturer's protocol. The number of antibody binding sites presenton these cells was determined using a Bangs QFACSTM Kit.
In Vitro Model Lung adenocarcinoma NCI-H1975 cells CVCL_1511
Experiment 10 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 100 nM Negative CD276 expression (CD276 -)
Method Description
Briefly, B7-H3-ADCs and controls are diluted and plated intomicrotiter plates, 5000 cells are added to each well and incubated at 37°C for 4-7 daysAlamar Blue Reagent is added to the plates andread according to the manufacturer's protocol. The number of antibody binding sites presenton these cells was determined using a Bangs QFACSTM Kit.
In Vitro Model EBV-related Burkitt lymphoma Raji cells CVCL_0511
References
Ref 1 Novel b7-h3 binding molecules, antibody drug conjugates thereof and methods of use thereof; 2017-10-19.