Antibody Information
General Information of This Antibody
| Antibody ID | ANI0RYL001 |
|||||
|---|---|---|---|---|---|---|
| Antibody Name | Tizetatug |
|||||
| Organization | Suzhou Suncadia Biopharmaceuticals Co., Ltd.; Shanghai Hengrui Pharmaceutical Co., Ltd. |
|||||
| Synonyms |
Tizetatug
Click to Show/Hide
|
|||||
| Antibody Type | Monoclonal antibody (mAb) |
|||||
| Antigen Name | Tumor-associated calcium signal transducer 2 (TACSTD2) |
Antigen Info | ||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Sequence |
EVQLVQSGSELKKPGASVKVSCKASGYTFTNYGMNWVKQAPGQGLKWMGWINTYTGEPTY
TQDFKGRFAFSLDTSVSTAYLQISSLKAEDTAVYYCARGGFGSSYWYFDVWGQGTLVTVS S Click to Show/Hide
|
|||||
| Light Chain Sequence |
DIQLTQSPSSLSASVGDRVSITCKASQDVSIAVAWYQQKPGKAPKLLIYSASYRYTGVPD
RFSGSGSGTDFTLTISSLQPEDFAVYYCQQHYITPLTFGAGTKVEIK Click to Show/Hide
|
|||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
Tizetatug rezetecan [Phase 3]
Identified from the Human Clinical Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Progression Free Survival |
7.4 months
|
|||
| Patients Enrolled |
Eligible participants (18-75 years) must have advanced/metastatic malignancies refractory to standard therapy, measurable lesions (RECIST 1.1), ECOG 0-1, adequate organ function, and use contraception. Exclusions involve active CNS metastases, macrovascular invasion, symptomatic effusions, secondary malignancies, immunodeficiency, uncontrolled cardiac/ILD conditions, hepatitis B/C, recent anticoagulation/anti-tumor therapy, unresolved prior toxicities, or hypersensitivity to SHR-A1921 components.
Click to Show/Hide
|
||||
| Administration Dosage |
As of Mar 20, 2024, 46 PROC pts were enrolled (3.0 mg/kg, n=26; 2.0+2.0 mg/kg, n=20).
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT05154604 | Clinical Status | PHASE1 | ||
| Clinical Description |
A Phase 1 Multi-Center, Open-Label Study to Evaluate the Safety, Tolerability, Pharmacokinetics and Efficacy of SHR-A1921 in Subjects With Advanced Malignant Solid Tumour .
|
||||
| Primary Endpoint |
The primary endpoints include Dose Limited Toxicity (DLT) and Maximum Tolerable Dose (MTD) assessed within the first 21-day cycle, Recommended Phase II Dose (RP2D) determined during dose escalation, and incidence/grading of Adverse Events (AEs) per CTCAE v5.0 throughout the study (average 1 year duration).
|
||||
| Other Endpoint |
Pharmacokinetic parameters (Tmax, Cmax, AUC0-t, AUC0-∞, t1/2, CL, Vss, MRT, Css,max/min, Rac) and Anti-Drug Antibody (ADA) levels for SHR-A1921 and total antibody will be evaluated from screening to end of treatment (average 1 year). Efficacy measures include ORR, DoR, DCR (per RECIST 1.1), PFS, and OS.
|
||||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Objective Response Rate (ORR) |
48.80%
|
|||
| Patients Enrolled |
Eligible participants (18-75 years) must have advanced/metastatic malignancies refractory to standard therapy, measurable lesions (RECIST 1.1), ECOG 0-1, adequate organ function, and use contraception. Exclusions involve active CNS metastases, macrovascular invasion, symptomatic effusions, secondary malignancies, immunodeficiency, uncontrolled cardiac/ILD conditions, hepatitis B/C, recent anticoagulation/anti-tumor therapy, unresolved prior toxicities, or hypersensitivity to SHR-A1921 components.
Click to Show/Hide
|
||||
| Administration Dosage |
As of Mar 20, 2024, 46 PROC pts were enrolled (3.0 mg/kg, n=26; 2.0+2.0 mg/kg, n=20).
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT05154604 | Clinical Status | PHASE1 | ||
| Clinical Description |
A Phase 1 Multi-Center, Open-Label Study to Evaluate the Safety, Tolerability, Pharmacokinetics and Efficacy of SHR-A1921 in Subjects With Advanced Malignant Solid Tumour .
|
||||
| Primary Endpoint |
The primary endpoints include Dose Limited Toxicity (DLT) and Maximum Tolerable Dose (MTD) assessed within the first 21-day cycle, Recommended Phase II Dose (RP2D) determined during dose escalation, and incidence/grading of Adverse Events (AEs) per CTCAE v5.0 throughout the study (average 1 year duration).
|
||||
| Other Endpoint |
Pharmacokinetic parameters (Tmax, Cmax, AUC0-t, AUC0-∞, t1/2, CL, Vss, MRT, Css,max/min, Rac) and Anti-Drug Antibody (ADA) levels for SHR-A1921 and total antibody will be evaluated from screening to end of treatment (average 1 year). Efficacy measures include ORR, DoR, DCR (per RECIST 1.1), PFS, and OS.
|
||||
| Experiment 3 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Disease control rate (DCR) |
97.70%
|
|||
| Patients Enrolled |
Eligible participants (18-75 years) must have advanced/metastatic malignancies refractory to standard therapy, measurable lesions (RECIST 1.1), ECOG 0-1, adequate organ function, and use contraception. Exclusions involve active CNS metastases, macrovascular invasion, symptomatic effusions, secondary malignancies, immunodeficiency, uncontrolled cardiac/ILD conditions, hepatitis B/C, recent anticoagulation/anti-tumor therapy, unresolved prior toxicities, or hypersensitivity to SHR-A1921 components.
Click to Show/Hide
|
||||
| Administration Dosage |
As of Mar 20, 2024, 46 PROC pts were enrolled (3.0 mg/kg, n=26; 2.0+2.0 mg/kg, n=20).
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT05154604 | Clinical Status | PHASE1 | ||
| Clinical Description |
A Phase 1 Multi-Center, Open-Label Study to Evaluate the Safety, Tolerability, Pharmacokinetics and Efficacy of SHR-A1921 in Subjects With Advanced Malignant Solid Tumour .
|
||||
| Primary Endpoint |
The primary endpoints include Dose Limited Toxicity (DLT) and Maximum Tolerable Dose (MTD) assessed within the first 21-day cycle, Recommended Phase II Dose (RP2D) determined during dose escalation, and incidence/grading of Adverse Events (AEs) per CTCAE v5.0 throughout the study (average 1 year duration).
|
||||
| Other Endpoint |
Pharmacokinetic parameters (Tmax, Cmax, AUC0-t, AUC0-∞, t1/2, CL, Vss, MRT, Css,max/min, Rac) and Anti-Drug Antibody (ADA) levels for SHR-A1921 and total antibody will be evaluated from screening to end of treatment (average 1 year). Efficacy measures include ORR, DoR, DCR (per RECIST 1.1), PFS, and OS.
|
||||
| Experiment 4 Reporting the Activity Date of This ADC | [2] | ||||
| Patients Enrolled |
Eligible patients are HER2-negative advanced breast cancer patients (18-75 years, ECOG 0-1) with 1-2 prior systemic therapies, measurable lesions (RECIST v1.1), stable brain metastases allowed, and adequate organ function. Exclusions: active brain metastases needing treatment, prior PD- (L)1/HER2/TROP-2 therapy, uncontrolled infections, significant comorbidities (autoimmune, cardiac, pulmonary), recent live vaccines, or pregnancy.
Click to Show/Hide
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06433609 | Clinical Status | PHASE2 | ||
| Clinical Description |
A Phase II Study of Antibody-Drug Conjugates (ADCs) Combined With Adebrelimab in HER2-negative Advanced Breast Cancer
|
||||
| Primary Endpoint |
The primary efficacy endpoint is investigator-assessed ORR (confirmed CR/PR per RECIST v1.1) from randomization until disease progression/death during the 3.5-year follow-up period, evaluating tumor response rates in the study population.
|
||||
| Other Endpoint |
Secondary endpoints include DCR (CR+PR+SD), CBR (CR+PR+SD≥24 weeks), DoR (time from response to progression), PFS (from dose to progression/death), and OS (from dose to death) over 3.5 years. Safety is measured by AE occurrence/discontinuation rates throughout the study duration.
|
||||
| Experiment 5 Reporting the Activity Date of This ADC | [3] | ||||
| Patients Enrolled |
Eligible patients are HR+/HER2-, PD-L1+ advanced/metastatic breast cancer patients (18-75 years, ECOG 0-1) with ≥2 prior endocrine therapies (including CDK4/6i) and ≥1 chemotherapy line, measurable lesions (RECIST v1.1), and life expectancy ≥3 months. Exclusions: untreated/symptomatic CNS metastases (except stable post-treatment cases), prior TROP-2/PD- (L)1/ADC therapy, uncontrolled effusions, active infections, autoimmune/cardiovascular/lung diseases, recent immunosuppressants/live vaccines, or other malignancies within 5 years.
Click to Show/Hide
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06470672 | Clinical Status | PHASE2 | ||
| Clinical Description |
A Phase 2 Study of SHR-A1921 Combined Adebrelimab in Endocrine Therapy-failed HR-positive, HER2-negative Advanced Breast Cancer
|
||||
| Primary Endpoint |
The primary endpoint is ORR (confirmed CR/PR per RECIST v1.1), assessed every 6 weeks from baseline for up to 2 years to evaluate tumor response rates.
|
||||
| Other Endpoint |
Secondary endpoints include DCR (CR/PR/SD), DoR (time from response to progression), PFS (time from dose to progression/death), and OS (time from dose to death), all monitored over 2 years. Safety (AE incidence rate) is tracked from informed consent until 3 months post-treatment, including events leading to discontinuation.
|
||||
| Experiment 6 Reporting the Activity Date of This ADC | [4] | ||||
| Patients Enrolled |
Eligible patients are ≥18 years with locally advanced/metastatic breast cancer (any HR status, prior ADC and CDK4/6i if HR+), measurable disease (RECIST 1.1), adequate organ function (hematologic/hepatic/cardiac), ECOG≤2, and life expectancy≥3 months. Exclusions: untreated CNS metastases, uncontrolled effusions/heart disease/HIV/hepatitis B/C, recent immunosuppressants/surgery/radiotherapy, active autoimmune conditions, pregnancy, other malignancies within 5 years, or severe comorbidities per investigator judgment.
Click to Show/Hide
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06649331 | Clinical Status | PHASE2 | ||
| Clinical Description |
Platform Study of ADC Rechallenge in ADC-treated Metastatic Breast Cancer:A Prospective, Open-label, Multicenter, Phase II Trial
|
||||
| Primary Endpoint |
The primary efficacy endpoint is ORR, defined as complete or partial response per RECIST 1.1, evaluated in participants with measurable disease over a 36-month observation period to determine treatment response rates.
|
||||
| Other Endpoint |
Secondary endpoints include PFS (time from randomization to progression/death), CBR (CR/PR/SD≥24 weeks), DOR (duration from first response to progression), OS (time from randomization to death over 5 years), and treatment-related toxicity rates (CTCAEv5-graded AEs) monitored for 36 months.
|
||||
| Experiment 7 Reporting the Activity Date of This ADC | [5] | ||||
| Patients Enrolled |
Eligible patients are ≥18 years with HR-/HER2- metastatic breast cancer, ECOG 0-2, MRI-confirmed untreated brain metastases (≥1 cm), stable neurologic symptoms, and adequate organ function (hematologic/hepatic/cardiac). Exclusions: leptomeningeal/cystic metastases, uncontrolled effusions, recent anti-cancer therapies (including bevacizumab/TROP-2 ADC), active HBV/HCV/HIV, severe cardiac/neurologic conditions, pregnancy, or other malignancies within 5 years (except cured non-invasive cancers). Investigators may exclude patients with uncontrolled comorbidities.
Click to Show/Hide
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06210438 | Clinical Status | PHASE2 | ||
| Clinical Description |
SHR-A1921 Combined With Bevacizumab in Triple-negative Breast Cancer With Brain Metastases:a Prospective, Single-arm, Single-center Phase II Clinical Study
|
||||
| Primary Endpoint |
The primary endpoint is CNS ORR, defined as the proportion of patients achieving complete or partial response in the central nervous system as per RANO-BM criteria, evaluated from enrollment until CNS progression or death over 24 months.
|
||||
| Other Endpoint |
Secondary endpoints include CNS CBR (CR/PR/SD ≥24 weeks), PFS (time from first dose to progression/death), OS (time from first dose to death), first progression site analysis, and safety (AE incidence per NCI-CTCAE v5.0), all monitored for up to 2 years.
|
||||
| Experiment 8 Reporting the Activity Date of This ADC | [6] | ||||
| Patients Enrolled |
Exclusion criteria include recent radiotherapy/chemotherapy/immunotherapy (except bisphosphonates for bone mets), uncontrolled CNS metastases, significant cardiac disease (e.g., recent MI/CHF), unresolved grade≥1 treatment-related AEs (excluding alopecia), major surgery within 3 weeks, pregnancy/lactation, or other malignancies (except cured non-melanoma skin/CIS cervical cancer) within 5 years.
Click to Show/Hide
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT05594095 | Clinical Status | PHASE2 | ||
| Clinical Description |
Precision Platform Study of HR+/ HER2-advanced Breast Cancer Based on SNF Typing (A Prospective, Open-label, Multi-center, Phase II Platform Study)
|
||||
| Primary Endpoint |
This study evaluates the overall response rate (ORR), defined as the proportion of participants achieving complete or partial remission (per RECIST 1.1) from randomization to disease progression/death, alongside secondary endpoints including clinical benefit rate (CBR), progression-free survival (PFS), overall survival (OS), CTCAE v5.0-assessed adverse events, and exploratory biomarker analysis in tumor, paracancerous tissues, blood, and fecal samples.
Click to Show/Hide
|
||||
| Other Endpoint |
Eligible participants must be female (≥18 years) with HR+/HER2- locally advanced or recurrent metastatic breast cancer, having previously received CDK4/6 inhibitors. They must have ≥1 measurable lesion (RECIST 1.1), adequate organ function (HB≥90g/L, ANC≥1.5x10^9/L, PLT≥75x10^9/L, ALT/AST≤3xULN [≤5xULN if liver mets], Cr clearance >50mL/min), ECOG≤2, and life expectancy≥3 months. Fertile women must use contraception during and 3 months post-study.
Click to Show/Hide
|
||||
| Experiment 9 Reporting the Activity Date of This ADC | [7] | ||||
| Patients Enrolled |
Exclusions include other active malignancies (except cured localized cancers), recent antitumor therapy (within 28 days; waived if drug half-life ≥5×), uncontrolled cardiac conditions (NYHA≥II, LVEF<50%, QTc>450/470ms), hypertension unmanageable by medication, malabsorption risks (arm 2 only), bleeding risks (active ulcers, INR>1.5×ULN), or uncontrolled coagulopathy (aPTT>1.5×ULN).
Click to Show/Hide
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT05924256 | Clinical Status | PHASE2 | ||
| Clinical Description |
A Phase II Study of Advanced Salivary Gland Carcinoma Based on Molecular Typing
|
||||
| Primary Endpoint |
This study assesses the objective response rate (ORR) based on RECIST 1.0 criteria and disease control rate (DCR) including complete/partial responses and stable disease, evaluated every 2 cycles (21-day cycles for arms 1,3,4; 28-day for arm 2). Secondary endpoints include median progression-free survival (PFS) and overall survival (OS) tracked over 2 years, plus adverse events (CTCAE 5.0) monitored from consent until 30 days post-treatment.
Click to Show/Hide
|
||||
| Other Endpoint |
Eligible participants (18-75 years) must have histologically confirmed locally advanced/metastatic salivary gland carcinoma, stratified by HER-2/AR status (arms 1-4), ≥1 measurable lesion (RECIST 1.1), ECOG 0-1, and adequate organ function (HB≥90g/L, ANC≥1.5×109/L, PLT≥80×109/L, ALT/AST≤2.5×ULN [≤5×ULN if liver mets], Cr≤1×ULN). Fertile individuals must use contraception during and 8 weeks post-study.
Click to Show/Hide
|
||||
| Experiment 10 Reporting the Activity Date of This ADC | [8] | ||||
| Patients Enrolled |
Eligible participants (18-75 years) must have histologically/cytologically confirmed unresectable locally advanced or metastatic non-small cell lung cancer, ≥1 measurable lesion (RECIST v1.1), ECOG 0-1, and adequate organ function. Key exclusions include untreated CNS/metastasis, uncontrolled symptomatic effusions, active autoimmune/cardiac disease, prior topoisomerase I inhibitors/TROP-2 ADC/anti-PD-1/L1/CTLA-4 therapy, or hypersensitivity to SHR-A1921/Adebrelimab components.
Click to Show/Hide
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06434103 | Clinical Status | PHASE1|||PHASE2 | ||
| Clinical Description |
An Open, Multicenter Phase I/II Trial of SHR-A1921 in Combination With Adebrelimab and SHR-8068 With or Without Carboplatin in the Treatment of Advanced NSCLC
|
||||
| Primary Endpoint |
The study evaluates dose-limiting toxicities (DLT) within 21 days post-first dose and objective response rate (ORR) per RECIST v1.1, assessed every 6-9 weeks from treatment initiation for up to 2 years.
|
||||
| Other Endpoint |
Adverse events are monitored from informed consent through the safety follow-up period (up to 2 years), alongside disease control rate (DCR) assessed per RECIST v1.1 at 6-9 week intervals during treatment.
|
||||
| Experiment 11 Reporting the Activity Date of This ADC | [9] | ||||
| Patients Enrolled |
Eligible participants (18-75 years) must have metastatic NSCLC (AJCC/UICC 8th ed.) progressing after standard/antibody-conjugated therapy, ≥1 measurable lesion (RECIST 1.1), ECOG 0-1, life expectancy ≥12 weeks, and adequate organ function, with contraception use mandated. Exclusions include untreated CNS metastases, active effusions, prior thoracic radiotherapy/surgery, secondary malignancies, uncontrolled comorbidities (cardiac/pulmonary/HTN), hepatitis B/C, unresolved treatment toxicity, or hypersensitivity to study drugs (SHR-A1921/A2009), with investigator discretion for other risk factors.
Click to Show/Hide
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06465238 | Clinical Status | PHASE2 | ||
| Clinical Description |
A Phase II Study of the Efficacy and Safety of SHR-A1921 or SHR-A2009 in Patients With Previously Treated Advanced NSCLC
|
||||
| Primary Endpoint |
The primary endpoint is overall response rate (ORR) assessed by investigators per RECIST v1.1 over 12 months, alongside progression-free survival (PFS), duration of response (DoR), disease control rate (DCR), and time to response (TTR) evaluated using the same criteria during this period.
|
||||
| Other Endpoint |
Overall survival (OS) is tracked for 24 months from first dose, while adverse events (AEs) are documented from Day 1 until 90 days post-last dose and graded via CTCAE v5.0 for severity analysis.
|
||||
| Experiment 12 Reporting the Activity Date of This ADC | [10] | ||||
| Patients Enrolled |
Exclusions include prior topoisomerase I inhibitors/TROP2 therapy, grade≥3 immune-related AEs, untreated/symptomatic CNS metastases, uncontrolled effusions, recent radiotherapy/chemo/surgery (within 4-6 weeks), other malignancies (5 years), interstitial lung disease, active infections (TB/HBV/HCV), uncontrolled hypertension (≥140/90 mmHg), severe allergies to study drugs, or investigator-judged risks (e.g., substance abuse, psychosocial factors).
Click to Show/Hide
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06480136 | Clinical Status | PHASE2 | ||
| Clinical Description |
An Exploratory Clinical Study of SHR-A1921 Combined With Adebrelimab in the Treatment of Advanced NSCLC Who Failed the Previous Standard First-line Treatment
|
||||
| Primary Endpoint |
Objective response rate (ORR), defined as the proportion of patients with tumor shrinkage/disappearance per RECIST v1.1, will be assessed from screening through study completion (average 2 years), alongside progression-free survival (PFS), duration of response (DoR), overall survival (OS), and disease control rate (DCR) for comprehensive efficacy evaluation over the same timeframe.
Click to Show/Hide
|
||||
| Other Endpoint |
Eligibility requires histologically/cytologically confirmed advanced/metastatic NSCLC (IASLC TNM stage IIIb-IV) unsuitable for curative treatment, progression post-immunotherapy/platinum chemo, ≥1 measurable lesion (RECIST v1.1), ECOG 0-1, life expectancy ≥12 weeks, and adequate organ function (ANC≥1.5×109/L, ALT/AST≤3×ULN, LVEF≥50%). Non-squamous patients must lack EGFR/ALK/ROS1 mutations. Contraception is mandatory (6 months post-treatment).
Click to Show/Hide
|
||||
| Experiment 13 Reporting the Activity Date of This ADC | [11] | ||||
| Patients Enrolled |
Key exclusions comprise uncontrolled symptomatic effusions, prior/concurrent malignancies, active hepatitis B/C, interstitial lung disease requiring steroids, recent systemic anti-tumor therapy (within 4 weeks), prior TOP1 inhibitors or TROP-2 ADC treatment, and unresolved CTCAE ≥grade 2 toxicities from earlier therapies.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06211023 | Clinical Status | PHASE2|||PHASE3 | ||
| Clinical Description |
An Open-label, Randomized, Controlled, Phase II/III Study of SHR-A1921 With or Without Carboplatin Verus Investigator's Choice of Platinum-based Doublet Chemotherapy in Patients With Recurrent Epithelial Ovarian Cancer
|
||||
| Primary Endpoint |
The primary efficacy measure is Objective Response Rate (ORR) assessed by investigators per RECIST v1.1 from screening through study completion (average 1 year), accompanied by additional evaluations including Duration of Response (DoR), Disease Control Rate (DCR), and Progression-Free Survival (PFS) using RECIST v1.1, while Overall Survival (OS) and CA-125 Response per GCIG criteria are also analyzed over the same timeframe.
Click to Show/Hide
|
||||
| Other Endpoint |
Eligible participants must have histologically confirmed epithelial ovarian, primary peritoneal, or fallopian tube cancer, provide fresh/archived tumor tissue, possess ≥1 measurable lesion (RECIST v1.1), ECOG 0-1, life expectancy ≥12 weeks, and adequate bone marrow/organ function. Patients must voluntarily consent to enrollment.
|
||||
| Experiment 14 Reporting the Activity Date of This ADC | [12] | ||||
| Patients Enrolled |
Exclusions involve uncontrolled symptomatic effusions, prior/concurrent malignancies, active hepatitis B/C, interstitial lung disease (ILD), uncontrolled cardiac conditions, recent thrombosis/bleeding (≥CTCAE grade 2), gastrointestinal perforation/fistula, intestinal obstruction, severe pre-dose infections, prior TOP1 inhibitor/ADC therapy, unresolved toxicity (≥grade 2), hypersensitivity to SHR-A1921 components, or other investigator-determined contraindications.
Click to Show/Hide
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06394492 | Clinical Status | PHASE3 | ||
| Clinical Description |
A Randomized, Open-Label, Controlled, Phase III Study of SHR-A1921 Versus Investigator's Choice of Chemotherapy in Patients With Platinum-Resistant Recurrent Epithelial Ovarian Cancer
|
||||
| Primary Endpoint |
The primary endpoint is Progression-Free Survival (PFS) evaluated by a Blinded Independent Review Committee (BIRC) according to RECIST 1.1 over a 1-year period, supplemented by secondary endpoints including Overall Survival (OS), Objective Response Rate (ORR), Duration of Response (DoR), Disease Control Rate (DCR) assessed by site investigators per RECIST 1.1, alongside Response Rate (RR) by RECIST 1.1/GCIG criteria and CA-125 Response per GCIG criteria, with Adverse Events also monitored throughout the study.
Click to Show/Hide
|
||||
| Other Endpoint |
Eligible participants must be female, aged ≥18, with pathologically confirmed platinum-resistant epithelial ovarian, primary peritoneal, or fallopian tube cancer, provide fresh/archived tumor tissue, have ≥1 measurable lesion (RECIST 1.1), ECOG 0-1, life expectancy ≥12 weeks, adequate organ function, and agree to contraception. Voluntary informed consent is mandatory.
Click to Show/Hide
|
||||
| Experiment 15 Reporting the Activity Date of This ADC | [13] | ||||
| Patients Enrolled |
Eligible participants must provide informed consent, supply adequate tumor tissue samples, and have confirmed advanced solid tumors (recurrent, unresectable, or metastatic) after failing standard therapy, with ECOG 0-1. Exclusion criteria include uncontrolled symptomatic effusions, untreated brain/meningeal metastases, prior malignancies, AIDS, uncontrolled cardiovascular disease (NYHA ≥2), interstitial lung disease, recent hemorrhage (≥grade 2), active hepatitis B, SHR-1921 hypersensitivity, or other investigator-determined interference factors.
Click to Show/Hide
|
||||
| Administration Dosage |
Subject will receive a single dose of SHR-1921 at dose level 1/2/3 on Day of each cycles
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT05594875 | Clinical Status | PHASE1 | ||
| Clinical Description |
An Open-Label, Multi-Center Phase I Clinical Study on the Safety, Tolerability, Pharmacokinetics, and Clinical Activity of SHR-A1921 for Injection in Subjects With Advanced Solid Tumors
|
||||
| Primary Endpoint |
The safety profile of the study will be assessed through monitoring adverse events (AEs), clinically significant laboratory abnormalities, vital sign variations (including blood pressure and pulse rate), and ECG readings (with emphasis on QT interval abnormalities) over a 1-year timeframe for all enrolled participants.
|
||||
| Other Endpoint |
Pharmacokinetic parameters of SHR-1921 will be evaluated, including maximum plasma concentration (Cmax), area under the curve (AUC 0-∞), time to reach Cmax (Tmax), drug clearance (CL/F), and terminal elimination half-life (t1/2). Additionally, immunogenicity will be assessed by measuring anti-drug antibodies (ADA) in participant blood samples throughout the study period.
Click to Show/Hide
|
||||
| Experiment 16 Reporting the Activity Date of This ADC | [14] | ||||
| Patients Enrolled |
Eligible participants (18-75 years, ECOG 0-1) must have measurable lesions (RECIST v1.1); Phase 1b: advanced solid tumors; Phase II: metastatic NSCLC. Exclusions include untreated brain/meningeal metastases, uncontrolled symptomatic effusions, concurrent malignancies (except certain cured cancers), uncontrolled hypertension, active autoimmune diseases, or tuberculosis. Contraception is required for WOCBP and male partners.
Click to Show/Hide
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT05765032 | Clinical Status | PHASE1|||PHASE2 | ||
| Clinical Description |
An Open Label, Multicenter, Phase Ib/II Study of SHR-A1921 in Combination With Other Anti-cancer Agents in Patients With Advanced Solid Tumors
|
||||
| Primary Endpoint |
Phase 1b evaluates Dose-Limiting Toxicity (DLT) incidence and determines Recommended Phase II Dose (RP2D) within the first 21-day cycle. Phase II assesses Objective Response Rate (ORR) per RECIST v1.1 until disease progression or death (~1 year).
|
||||
| Other Endpoint |
Efficacy measures include ORR (Phase 1b only), Duration of Response (DoR), Disease Control Rate (DCR), Time to Response (TTR), and Progression-Free Survival (PFS), all per RECIST v1.1 (~1 year follow-up). Overall Survival (OS) is tracked for ~12 months post-final enrollment.
|
||||
| Experiment 17 Reporting the Activity Date of This ADC | [15] | ||||
| Patients Enrolled |
Eligible patients (18-75 years, ECOG 0-1, life expectancy ≥12 weeks) must have histologically confirmed advanced/metastatic solid tumors, ≥1 measurable lesion (RECIST v1.1), and adequate organ function. Exclusions include active CNS metastases, uncontrolled effusions/pain, recent anti-tumor therapy (≤4 weeks), interstitial lung disease, severe cardiovascular conditions, HIV/HBV/HCV positivity, drug allergies, or pregnancy/lactation.
Click to Show/Hide
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06474455 | Clinical Status | PHASE1|||PHASE2 | ||
| Clinical Description |
A Phase IB/II, Open-Label, Multicentre Clinical Study to Evaluate the Safety, Tolerability and Efficacy of SHR-9839 for Injection in Combination With Other Therapies in Patients With Advanced Solid Tumors
|
||||
| Primary Endpoint |
Phase IB evaluates incidence of Dose-Limiting Toxicity (DLT) within 21 days post-first dose (up to ~24 months) and monitors adverse events (AEs)/serious AEs (SAEs) per CTCAE v5.0 from consent to safety follow-up. Phase II assesses Objective Response Rate (ORR) per RECIST 1.1 until disease progression (~24 months).
|
||||
| Other Endpoint |
Phase II additionally tracks AE/SAE incidence and severity (CTCAE v5.0) from informed consent through safety follow-up (~24 months), reinforcing safety and tolerability profiling of SHR-A2009.
|
||||
| Experiment 18 Reporting the Activity Date of This ADC | [16] | ||||
| Patients Enrolled |
Eligible participants (18-75 years, ECOG 0-1, expected survival ≥12 weeks) must provide consent and have ≥1 measurable lesion (RECIST v1.1). Exclusions include: uncontrolled psychiatric/medical conditions; HRS-4642 hypersensitivity; recent surgery/trauma (≤28/7 days); live vaccine use (≤28 days); HIV/immunodeficiency; active/past untreated tuberculosis; hepatitis B; pancreatitis; uncontrolled cardiovascular/thrombotic events; or gastrointestinal obstruction (≤6 months).
Click to Show/Hide
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06520488 | Clinical Status | PHASE1|||PHASE2 | ||
| Clinical Description |
Phase IB/II Clinical Study of the Safety, Tolerability and Efficacy of HRS-4642 in Combination With Anti-tumor Agents in Subjects With Advanced Solid Tumors
|
||||
| Primary Endpoint |
Phase IB evaluates Dose-Limiting Toxicities (DLTs) within 28 days post-first dose and monitors adverse events (AEs) over ~1 year. Phase II measures investigator-assessed Objective Response Rate (ORR) every 6 weeks for ~1 year.
|
||||
| Other Endpoint |
Phase IB additionally tracks ORR (every 6 weeks, ~1 year). Phase II assesses Disease Control Rate (DCR), Duration of Response (DoR), Progression-Free Survival (PFS), and Overall Survival (OS) every 6 weeks (extended to monthly for OS) plus AE incidence/severity monthly (~1 year).
|
||||
| Experiment 19 Reporting the Activity Date of This ADC | [17] | ||||
| Related Clinical Trial | |||||
| NCT Number | NCT05594875 | Clinical Status | Phase 1 | ||
| Clinical Description |
An open-label, multi-center phase 1 clinical study on the safety, tolerability, pharmacokinetics, and clinical activity of SHR-A1921 for injection in subjects with advanced solid tumors.
|
||||
| Experiment 20 Reporting the Activity Date of This ADC | [18] | ||||
| Related Clinical Trial | |||||
| NCT Number | NCT05154604 | Clinical Status | Phase 1 | ||
| Clinical Description |
A phase 1 multi-center, open-label study to evaluate the safety, tolerability, pharmacokinetics and efficacy of SHR-a1921 in subjects with advanced malignant solid tumour.
|
||||
| Experiment 21 Reporting the Activity Date of This ADC | [19] | ||||
| Related Clinical Trial | |||||
| NCT Number | NCT05765032 | Clinical Status | Phase 1 | ||
| Clinical Description |
An open label, multicenter, phase 1b/2 study of SHR-A1921 in combination with other anti-cancer agents in patients with advanced solid tumors.
|
||||
References
