General Information of This Antibody
Antibody ID
ANI0RYL001
Antibody Name
Tizetatug
Antigen Name
Tumor-associated calcium signal transducer 2 (TACSTD2)
 Antigen Info 
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence
EVQLVQSGSELKKPGASVKVSCKASGYTFTNYGMNWVKQAPGQGLKWMGWINTYTGEPTY
TQDFKGRFAFSLDTSVSTAYLQISSLKAEDTAVYYCARGGFGSSYWYFDVWGQGTLVTVS
S
    Click to Show/Hide
Light Chain Sequence
DIQLTQSPSSLSASVGDRVSITCKASQDVSIAVAWYQQKPGKAPKLLIYSASYRYTGVPD
RFSGSGSGTDFTLTISSLQPEDFAVYYCQQHYITPLTFGAGTKVEIK
    Click to Show/Hide
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
SHR-A1921 [Phase 2]
Identified from the Human Clinical Data
Click To Hide/Show 3 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Related Clinical Trial
NCT Number NCT05765032  Clinical Status Phase 1
Clinical Description
An open label, multicenter, phase 1b/2 study of SHR-A1921 in combination with other anti-cancer agents in patients with advanced solid tumors.
Experiment 2 Reporting the Activity Date of This ADC [2]
Related Clinical Trial
NCT Number NCT05594875  Clinical Status Phase 1
Clinical Description
An open-label, multi-center phase 1 clinical study on the safety, tolerability, pharmacokinetics, and clinical activity of SHR-A1921 for injection in subjects with advanced solid tumors.
Experiment 3 Reporting the Activity Date of This ADC [3]
Related Clinical Trial
NCT Number NCT05154604  Clinical Status Phase 1
Clinical Description
A phase 1 multi-center, open-label study to evaluate the safety, tolerability, pharmacokinetics and efficacy of SHR-a1921 in subjects with advanced malignant solid tumour.
References
Ref 1 An Open Label, Multicenter, Phase Ib/II Study of SHR-A1921 in Combination With Other Anti-cancer Agents in Patients With Advanced Solid Tumors, NCT05765032
Ref 2 An Open-Label, Multi-Center Phase I Clinical Study on the Safety, Tolerability, Pharmacokinetics, and Clinical Activity of SHR-A1921 for Injection in Subjects With Advanced Solid Tumors, NCT05594875
Ref 3 A Phase 1 Multi-Center, Open-Label Study to Evaluate the Safety, Tolerability, Pharmacokinetics and Efficacy of SHR-A1921 in Subjects With Advanced Malignant Solid Tumour. NCT05154604