General Information of This Antibody (ID: ANI0QYT013)
Antibody Name
Idactamab
Organization
AstraZeneca PLC
Synonyms
Idactamab
   Click to Show/Hide
Antibody Type
Monoclonal antibody (mAb)
Antigen Name
Neutral amino acid transporter B(0) (SLC1A5)
 Antigen Info 
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence
QVQLQQWGAGLLKPSETLSLTCAVYGGSFSGYYWSWIRQPPGKGLEWIGEIHHSGGANYN
PSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARGQGKNWHYDYFDYWGQGTLVTVS
S
    Click to Show/Hide
Light Chain Sequence
DIQMTQSPSTLSASVGDRVTITCRASQSIRSWLAWYQQKPGKAPKLLIYKASILKIGVPS
RFSGSGSGTEFTLTISSLQPDDFATYYCQQYYSYSRTFGQGTKVEIK
    Click to Show/Hide
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
MEDI7247 [Phase 1 (discontinued)]
Identified from the Human Clinical Data
Click To Hide/Show 2 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Patients Enrolled
Eligible patients must have relapsed/refractory hematologic malignancies with no standard therapies available, be ≥18 years old, ECOG 0-1, and meet organ function criteria (liver, renal). Contraception is required for sexually active participants. Exclusions include recent chemotherapy/surgery/radiotherapy, unresolved toxicities, active infections (HIV/HBV/HCV), CNS involvement, or high bleeding risk. Prior autologous SCT within 120 days or unresolved transplant-related toxicities also disqualify.

   Click to Show/Hide
Administration Dosage
The study will enroll patients with R/R AML/MM/DLBCL who will receive MEDI7247 IV
Related Clinical Trial
NCT Number NCT03106428  Clinical Status PHASE1
Clinical Description
A Phase 1 Multicenter, Open-label, Dose-escalation and Dose-expansion Study to Evaluate the Safety, Tolerability, Pharmacokinetics, Pharmacodynamics, Immunogenicity and Antitumor Activity of MEDI7247 in Patients With Selected Relapsed/Refractory Hematological Malignancies
Primary Endpoint
The study evaluates safety endpoints including adverse events (AEs), serious adverse events (SAEs), and dose-limiting toxicities (DLTs) monitored from informed consent through 90 days post-treatment. Laboratory parameters, vital signs, and ECG results are assessed for changes from baseline up to 21 days post-treatment, covering hematology, serum chemistry, coagulation, urinalysis, and cardiovascular metrics.

   Click to Show/Hide
Other Endpoint
Pharmacokinetic (PK) analysis of MEDI7247 includes maximum concentration (Cmax), area under the curve (AUC), clearance, and terminal half-life, measured from informed consent through 30 days post-treatment. Immunogenicity is assessed via anti-drug antibodies (ADAs). Anti-tumor activity is evaluated by best overall response (BOR), objective response rate (ORR), time to response (TTR), duration of response (DoR), progression-free survival (PFS), and overall survival (OS), tracked up to 3 years post-enrollment.

   Click to Show/Hide
Experiment 2 Reporting the Activity Date of This ADC [2]
Patients Enrolled
Eligible patients must have advanced/metastatic solid tumors refractory to standard therapies, be ≥18 years old, ECOG 0-1, and meet organ function criteria (liver, renal, hematologic). Contraception is required for sexually active participants. Exclusions include active CNS metastases (unless treated/stable), unresolved toxicities (>Grade 1), recent anticancer therapy (within 21 days), prior PBD-ADCs, high-risk cardiac conditions, active infections (HIV/HBV/HCV), pregnancy, or concurrent investigational studies. Major surgery or significant trauma within 21 days also disqualifies.

   Click to Show/Hide
Administration Dosage
Subjects with advanced solid tumors will enroll into the respective arms to receive Medi7247 IV at prescribed dose and schedule
Related Clinical Trial
NCT Number NCT03811652  Clinical Status PHASE1
Clinical Description
A Phase 1/1b Multicenter, Open-label, Dose-escalation, and Dose-expansion Study to Evaluate the Safety, Tolerability, Pharmacokinetics, Immunogenicity, and Antitumor Activity of MEDI7247 in Patients With Advanced or Metastatic Disease in Selected Solid Tumors
Primary Endpoint
The study evaluates safety outcomes including adverse events (AEs), serious adverse events (SAEs), and dose-limiting toxicities (DLTs) monitored from informed consent through 90 days post-treatment. Laboratory parameters, vital signs, and ECG results are assessed for changes from baseline up to 90 days post-treatment, covering hematology, serum chemistry, urinalysis, and coagulation metrics.

   Click to Show/Hide
Other Endpoint
Pharmacokinetic (PK) analysis of MEDI7247 includes maximum concentration (Cmax), terminal half-life (t1/2), area under the curve (AUC), and clearance, measured from first dose through 90 days post-treatment. Immunogenicity is assessed via anti-drug antibodies (ADAs). Anti-tumor activity is evaluated by best overall response (BOR), objective response rate (ORR), time to response (TTR), duration of response (DoR), progression-free survival (PFS), disease control (DC), and overall survival (OS), tracked up to 2 years post-enrollment.

   Click to Show/Hide
References
Ref 1 A Multiple Ascending Dose Study of MEDI7247 in Patients With Selected Relapsed/?Refractory Hematological Malignancies
Ref 2 A Multiple Ascending Dose Study of MEDI7247 in Advanced or Metastatic Solid Tumors