Antibody Information
General Information of This Antibody (ID: ANI0QYT007)
| Antibody Name | Samatatug |
|||||
|---|---|---|---|---|---|---|
| Organization | Iconic Therapeutics, Inc.; Exelixis, Inc.; Exelis, Inc. |
|||||
| Synonyms |
Samatatug
Click to Show/Hide
|
|||||
| Antibody Type | Monoclonal antibody (mAb) |
|||||
| Antigen Name | Tissue factor (F3) |
Antigen Info | ||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Sequence |
QVQLVQSGAEVKKPGASVKVSCKASGYTFDVYGISWVRQAPGQGLEWMGWIAPYSGNTNY
AQKLQGRVTMTTDTSTSTAYMELRSLRSDDTAVYYCARDAGTYSPFGYGMDVWGQGTTVT VSS Click to Show/Hide
|
|||||
| Light Chain Sequence |
DIQMTQSPSTLSASVGDRVTITCQASQSINNWLAWYQQKPGKAPKLLIYKAYNLESGVPS
RFSGSGSGTEFTLTISSLQPDDFATYYCQLFQSLPPFTFGGGTKVEIK Click to Show/Hide
|
|||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
Samatatug zovodotin [Phase 1 (discontinued)]
Identified from the Human Clinical Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Patients Enrolled |
Inclusion Criteria: Adults with inoperable/metastatic solid tumors (specific histologies for each cohort) who exhausted standard therapies. Required: measurable disease (RECIST 1.1), ECOG 0-1, adequate organ function, archived/fresh tumor tissue (≤3 years old), and controlled AEs (CTCAE v5 ≤G1). Exclusion Criteria: Prior disqualifying therapies, untreated brain metastases (unless stable ≥4 weeks post-treatment), major surgery (within 4 weeks), QTcF >480 ms, pregnancy/lactation, hypersensitivity to study drugs, or active malignancies (except cured non-melanoma skin cancers/localized tumors).
Click to Show/Hide
|
||||
| Administration Dosage |
Dose-escalation followed by cohort-expansion in tumor-specific expansion cohorts
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT04925284 | Clinical Status | PHASE1 | ||
| Clinical Description |
A Dose-Escalation and Expansion Study of the Safety and Pharmacokinetics of XB002 as Single-Agent and Combination Therapy in Subjects With Inoperable Locally Advanced or Metastatic Solid Tumors
|
||||
| Primary Endpoint |
The study's Dose-Escalation Stage aimed to determine the MTD/recommended dose (RD) of IV XB002 alone or in combination over 18 months. The Cohort-Expansion Stage assessed preliminary efficacy through ORR using RECIST 1.1 (or RANO/PCWG3 criteria) over 12 months.
|
||||
| Other Endpoint |
Safety and tolerability were evaluated via AEs/SAEs, treatment duration, and dose intensity over 30 months. Pharmacokinetics (Cmax, Ctrough) and immunogenicity (ADA) of XB002, total antibody, and free payload were analyzed. Anti-tumor activity was measured by ORR, DOR, and PFS (RECIST 1.1/RANO/PCWG3) through investigator/BIRC assessments. Overall survival was tracked in expansion cohorts for 12 months.
Click to Show/Hide
|
||||
