Antibody Information
General Information of This Antibody (ID: ANI0QYT004)
| Antibody Name | Delpacibart |
|||||
|---|---|---|---|---|---|---|
| Synonyms |
Delpacibart
Click to Show/Hide
|
|||||
| Antibody Type | Monoclonal antibody (mAb) |
|||||
| Antigen Name | Transferrin receptor protein 1 (TFRC) |
Antigen Info | ||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Sequence |
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYWMHWVRQAPGQGLEWIGEINPINGRSNY
AEKFQGRVTLTVDTSSSTAYMELSRLRSDDTAVYYCARGTRAMHYWGQGTLVTVSS Click to Show/Hide
|
|||||
| Light Chain Sequence |
DIQMTQSPSSLSASVGDRVTITCRTSENIYNNLAWYQQKPGKSPKLLIYAATNLADGVPS
RFSGSGSGTDYTLTISSLQPEDFATYYCQHFWGTPLTFGGGTKVEIK Click to Show/Hide
|
|||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
AOC-1020 [Phase 2]
Identified from the Human Clinical Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Patients Enrolled |
Key inclusion: Genetically confirmed FSHD1/2 (sponsor-tested), ambulatory (10m walk capacity), ≥1 biopsy-suitable muscle region, and documented upper/lower body weakness
|
||||
| Administration Dosage |
AOC 1020 Dose Regimen 1; Five doses administered intravenously over 9 months
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT05747924 | Clinical Status | PHASE1|||PHASE2 | ||
| Clinical Description |
A Randomized, Double-blind, Placebo-controlled, Phase 1/2 Study to Evaluate the Safety, Tolerability, Pharmacokinetics, Pharmacodynamics, and Exploratory Efficacy of AOC 1020 Administered Intravenously to Participants With Facioscapulohumeral Muscular Dystrophy (FSHD)
|
||||
| Primary Endpoint |
Primary endpoints include treatment-emergent AE incidence (Cohorts A/B) [up to Day 365], DUX4-regulated gene expression changes in muscle biopsies (Cohort C) [Day 120], and circulating FSHD biomarker changes (Cohort C) [Day 120].
|
||||
| Other Endpoint |
Secondary endpoints comprise AOC 1020 PK parameters (Cmax, half-life, AUC [up to Day 365]), muscle drug concentration [Day 120], and creatine kinase level changes [up to Day 365].
|
||||
| Experiment 2 Reporting the Activity Date of This ADC | [2] | ||||
| Patients Enrolled |
Ability to provide written informed consent (signed and dated) and any authorizations required by local law and be willing and able to comply with all study requirements. When enrolling participants who are minors, it is necessary to also obtain consent from a legally designated representative and the participant will receive information in a way adapted to their age and mental maturity.
Click to Show/Hide
|
||||
| Administration Dosage |
AOC 1020 Dose Regimen; Sixteen doses administered intravenously over 22 months. All participants will receive AOC 1020 at a dose level of 2mg/kg.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06547216 | Clinical Status | PHASE2 | ||
| Clinical Description |
A Phase 2 Open-label Extension Study to Evaluate the Long-Term Safety, Tolerability, and Efficacy of AOC 1020 Administered Intravenously to Participants with Facioscapulohumeral Muscular Dystrophy (FSHD)
|
||||
| Primary Endpoint |
Incidence of treatment-emergent adverse events [Time Frame: Through study completion, up to Day 729]
|
||||
| Experiment 3 Reporting the Activity Date of This ADC | [3] | ||||
| Related Clinical Trial | |||||
| NCT Number | NCT05747924 | Clinical Status | Phase 1 | ||
| Clinical Description |
A randomized, double-blind, placebo-controlled, phase 1/2 study to evaluate the safety, tolerability, pharmacokinetics, pharmacodynamics, and exploratory efficacy of AOC 1020 administered intravenously to adult participants with facioscapulohumeral muscular dystrophy (FSHD).
|
||||
References
