Antibody Information
General Information of This Antibody
| Antibody ID | ANI0QYT001 |
|||||
|---|---|---|---|---|---|---|
| Antibody Name | Olintatug |
|||||
| Organization | ADC Therapeutics SA; Overland Pharmaceuticals |
|||||
| Synonyms |
Olintatug
Click to Show/Hide
|
|||||
| Antibody Type | Monoclonal antibody (mAb) |
|||||
| Antigen Name | Kidney-associated antigen 1 (KAAG1) |
Antigen Info | ||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Sequence |
QIQLVQSGAEVKKPGASVKVSCKASGYTFTDDYMSWVKQAPGQGLEWIGDINPYNGDTNY
NQKFKGKATLTVDKSTSTAYMELSSLRSEDTAVYYCARDPGAMDYWGQGTLVTVSS Click to Show/Hide
|
|||||
| Light Chain Sequence |
DIVMTQTPLSLPVTPGEPASISCRSSQSLLHSNGNTYLEWYLQKPGQSPQLLIYTVSNRF
SGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCFQGSHVPLTFGQGTKLEIK Click to Show/Hide
|
|||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
Olintatug tesirine [Phase 1 (discontinued)]
Identified from the Human Clinical Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Patients Enrolled |
Eligible participants had advanced/metastatic solid tumors (cholangiocarcinoma, ovarian/prostate/RCC/TNBC), measurable disease per RECIST v1.1 (prostate cancer allowed with bone metastases + PSA ≥2 ng/mL). Exclusions included active infections, symptomatic CNS metastases (unless treated/asymptomatic for ≥4 weeks), clinically significant effusions, CTCAE Grade 2+ diarrhea, ocular surface disease (except managed mild dry eye), and recent experimental drug use (14-day washout).
Click to Show/Hide
|
||||
| Administration Dosage |
Part 1: pts will receive escalating doses of ADCT-901 guided by a 3+3 design (1st dose: 15 ug/kg every 3 weeks [Q3W]; highest dose: 290 ug/kg Q3W). Dose escalation will be evaluated by administering the lowest dose to first 3 pts, then increasing/decreasing the dose based on dose-limiting toxicity (DLT) experienced by pts.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT04972981 | Clinical Status | PHASE1 | ||
| Clinical Description |
A Phase 1, Open-Label, Dose-Escalation and Dose-Expansion Study to Evaluate the Safety, Tolerability, Pharmacokinetics, and Antitumor Activity of ADCT-901 as Monotherapy in Patients With Selected Advanced Solid Tumors
|
||||
| Primary Endpoint |
Safety was evaluated by AE/SAE incidence (including clinical lab/ECG changes) over 2.5 years, with DLTs tracked during dose escalation (Days 1-21), alongside dose modifications (interruptions/reductions).
|
||||
| Other Endpoint |
Efficacy endpoints (ORR, DOR, PFS, OS) and comprehensive PK parameters (Cmax, Tmax, AUC metrics, half-life, clearance, ADA response) for ADCT-901 components (total antibody, PBD-conjugated antibody, SG3199) were monitored throughout the 2.5-year study period.
|
||||
References