Antibody Information
General Information of This Antibody
| Antibody ID | ANI0NNTJU |
|||||
|---|---|---|---|---|---|---|
| Antibody Name | Fcab-1 |
|||||
| Antibody Type | Monoclonal antibody (mAb) |
|||||
| Antibody Subtype | Humanized IgG1 Fcab |
|||||
| Antigen Name | Epidermal growth factor receptor (EGFR) |
Antigen Info | ||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Sequence |
APELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVAVSHEDPEVKFNWYVDGVEVHNAKTK
PREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYT LPPSRDELDEGGPVSLTCLVKGFYPSDIAVEWESTYGPENNYKTTPPVLDSDGSFFLYSR LTVSHWRWYSGNVFSCSVMHEALHNHYTQKSLSLSPG Click to Show/Hide
|
|||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
Fcab-1-MMAE [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.18±0.03 nM
|
High EGFR expression (EGFR+++/++) | ||
| Method Description |
The inhibitory activity of Fcab-1-MMAE against cancer cell growth was evaluated in various human cancer cell lines in vitro.
|
||||
| In Vitro Model | Breast adenocarcinoma | MDA-MB-468 cells | CVCL_0419 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 100.00 nM | Negative EGFR expression (EGFR-) | ||
| Method Description |
The inhibitory activity of Fcab-1-MMAE against cancer cell growth was evaluated in various human cancer cell lines in vitro.
|
||||
| In Vitro Model | Invasive breast carcinoma | MCF-7 cells | CVCL_0031 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
1.40 nM
|
Low FOLR1 expression (FOLR1+) | ||
| Method Description |
The inhibitory activity of Fcab-1-MMAE against cancer cell growth was evaluated in various human cancer cell lines in vitro.
|
||||
| In Vitro Model | Skin squamous cell carcinoma | A431 cells | CVCL_0037 | ||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Shen et al.
